KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01512
Entry
SAOUHSC_01512     CDS       T00324                                 

Name
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: DUF1672 tRNA-synt_1c DUF6491
Other DBs
NCBI-GeneID: 3919053
NCBI-ProteinID: YP_500028
UniProt: Q2FYE2 A0A2X3YW35
Position
complement(1461363..1462280)
AA seq 305 aa
MFKRTKLILIATLLLSGCSTTNNESNKETKSVPEEMEASKYVGQGFQPPAEKDVVEFAKK
HKDKIAKRGEQFFMDNFGLKVKATNVVGSGKGVEVFVHCDDHDIVFNASIPFDKSIIESD
SSLRSEDKGDDMSTLVGTVLSGFEYRTQKEKYDNLYKFFKDNEEKYQYTGFTKEAINKTQ
NVGYKNEYFYITYSSRSLKEYRKYYEPLIHKNDKEFKEGMEQARKEVNYAANTDTVTTLF
STKENFTKDNTVDDVIELSDKLYNFKNKPEKSTITIQIGKPTINTKKAFYDDNDPIEYGV
YRKDE
NT seq 918 nt   +upstreamnt  +downstreamnt
atgtttaaaagaactaaactaatcttaatagcaacattactgctatcaggatgttcaact
accaataacgaatctaataaagaaacaaaatcagtgccagaagaaatggaagcttcaaaa
tatgtaggtcaaggcttccaaccacctgcagaaaaagatgtggttgaatttgcgaaaaag
cataaagataaaattgccaaacgaggcgaacaattttttatggataatttcggtctaaaa
gttaaagctaccaatgttgtaggtagtggaaaaggcgtagaagtattcgtgcattgtgat
gaccacgatatcgtatttaatgcgagtattccatttgataaatcaataattgagagtgat
agctcattaagaagtgaggacaaaggcgatgatatgagtactttagttggtacagtgttg
agtggctttgaatatcgaacacaaaaagaaaagtatgacaatttatataaatttttcaaa
gataatgaagagaaataccaatatacaggctttacaaaagaagcaataaacaagacgcaa
aatgtcggatataaaaatgaatatttttatatcacttactcgtcaagaagcttaaaagaa
tatcgtaagtattacgaaccattgattcataaaaatgataaagaatttaaagaaggaatg
gaacaagccagaaaagaagtgaattacgctgctaatacagatacagtaacaacattgttt
agtacaaaggaaaattttactaaagacaatacagttgatgatgtaattgaactgagtgat
aaactatataattttaaaaataagccagaaaaatctacaattacaattcaaataggaaag
cctactattaatactaaaaaagccttttatgatgataatgatccaatagaatatggagtg
tatcgtaaagatgaataa

DBGET integrated database retrieval system