KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01670
Entry
SAOUHSC_01670     CDS       T00324                                 

Definition
(RefSeq) cytidine deaminase
  KO
K01489  cytidine deaminase [EC:3.5.4.5]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00240  Pyrimidine metabolism
sao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAOUHSC_01670
Enzymes [BR:sao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     SAOUHSC_01670
SSDB
Motif
Pfam: dCMP_cyt_deam_1 dCMP_cyt_deam_2 LmjF365940-deam ADH_N DUF2685
Other DBs
NCBI-GeneID: 3920082
NCBI-ProteinID: YP_500181
UniProt: Q2FY04
Position
complement(1582690..1583094)
AA seq 134 aa
MSYQPHYFQEVRKAQQESYSPYSQFKVGAYLKTKDGRTFYGTNVENASYPLSICAERASL
VSAISQGYRPGDFESITVTVDADKPSSPCGACRQVLKELCDDDMPVYMTNHKGDMVMMTV
AELLPFGFSGKDLE
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagttatcaacctcattattttcaagaagttagaaaagcacaacaagaatcatattcg
ccatacagtcaatttaaagtaggggcttatttaaaaacgaaagacggtagaactttttat
ggtaccaatgtagaaaatgcttcttatccattatcgatatgtgctgaacgagctagtttg
gtatcggcaatttctcaaggatacagaccaggtgattttgaatcaataactgtaaccgta
gatgcagataaaccgtcatcaccttgtggtgcatgtcgtcaagttttgaaggaattatgt
gatgatgatatgcctgtgtatatgacaaatcataaaggagatatggttatgatgacagtc
gcagagttactaccatttggattttcaggaaaggatttagaataa

DBGET integrated database retrieval system