KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01950
Entry
SAOUHSC_01950     CDS       T00324                                 

Name
(RefSeq) flavoprotein EpiD
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: Flavoprotein HNH_2
Other DBs
NCBI-GeneID: 3920895
NCBI-ProteinID: YP_500449
UniProt: Q2FXB5 A0A2X3YTK6
Structure
PDB: 
3QJG

Position
complement(1852916..1853434)
AA seq 172 aa
MGENVLICLCGSVNSINISHYIIELKSKFDEVNVIASTNGRKFINGEILKQFCDNYYDEF
EDPFLNHVDIANKHDKIIILPATSNTINKIANGICDNLLLTICHTAFEKLSIFPNMNLRM
WENPVTQNNIRLLKDYGVSIYPANISESYELASKTFKKNVVAPEPYKVLEFI
NT seq 519 nt   +upstreamnt  +downstreamnt
atgggagaaaatgtattgatttgtttgtgtggctcagttaatagtatcaatattagccac
tatattattgaattaaaatcaaaatttgatgaagtaaatgtaatcgcgtcaacaaacggt
agaaagtttattaatggtgaaatattaaagcaattttgcgataactattatgacgaattt
gaagacccttttttaaatcatgtagatatagcaaataaacatgacaagattattatttta
cctgcgacttctaatacgattaataaaattgcaaatggtatatgtgacaatttattatta
actatttgtcatacagcttttgaaaaactttctatatttccaaatatgaatttacgaatg
tgggaaaatccagttactcaaaataatattcgattattaaaagattatggtgtatcaata
tatccagcaaatatttcagaaagttatgaattagcgtcaaaaacatttaaaaagaatgtt
gtcgcacctgaaccatataaagttctggaattcatttga

DBGET integrated database retrieval system