KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02070
Entry
SAOUHSC_02070     CDS       T00324                                 
Name
(RefSeq) phi PV83 orf 19-like protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: HNHc_6
Other DBs
NCBI-GeneID: 3919757
NCBI-ProteinID: YP_500563
UniProt: Q2FUP5
Position
complement(1957378..1958070)
AA seq 230 aa
MQYITRYQKDNDGTYSVVATGVELEQSHIDLLENGYPLKAEVEVPDNKKLSIEQRKKIFA
MCRDIELHWGEPVESTRKLLQTELEIMKGYEEISLRDCSMKVARELIELIIAFMFHHQIP
MSVETSKLLSEDKALLYWATINRNCVICGKPHADLAHYEAVGRGMNRNKMNHYDKHVLAL
CRQHHNEQHAIGVKSFDDKYHLHDSWIKVDERLNKMLKGENNGRSIVDKT
NT seq 693 nt   +upstreamnt  +downstreamnt
atgcaatacattacaagataccagaaagacaatgacggtacttattccgtcgttgctact
ggtgttgaacttgaacaaagtcacattgacttactagaaaacggatatccactaaaagca
gaagtagaggttccggacaataaaaaactatctatagaacaacgcaaaaaaatattcgca
atgtgtagagatatagaacttcactggggcgaaccagtagaatcaactagaaaattatta
caaacagaattggaaattatgaaaggttatgaagaaatcagtctgcgcgactgttctatg
aaagttgcaagggagttaatagaactgattatagcgtttatgtttcatcatcaaatacct
atgagtgtagaaacgagtaagttgttaagcgaagataaagcgttattatattgggctaca
atcaaccgcaactgtgtaatatgcggaaagcctcacgcagacctggcacattatgaagca
gtcggcagaggcatgaacagaaacaaaatgaatcactacgacaaacatgtgttagcactg
tgtagacaacatcataatgaacagcacgcaattggcgttaagtcgtttgatgataaatat
cacttgcatgactcgtggataaaagttgatgagaggctcaacaaaatgctgaaaggagaa
aacaatgggagaagtatcgtggataaaacttaa

DBGET integrated database retrieval system