KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02072
Entry
SAOUHSC_02072     CDS       T00324                                 
Name
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: AAA_24 Bac_DnaA SpoIISA_toxin TFIIE-A_C TsaE
Other DBs
NCBI-GeneID: 3919759
NCBI-ProteinID: YP_500565
UniProt: Q2FX33
Position
complement(1958667..1959446)
AA seq 259 aa
MTEKTNQDVDILTQLGVKDISKQNANKFYKFAIYGKFGTGKTTFLTKDNNALVLDINEDG
TTVTEDGAVVQIKNYKHFSAVIKMLPKIIEQLRENGKQIDVVVIETIQKLRDITMDDIMD
GKSKKPTFNDWGECATRIVSIYRYISKLQEHYQFHLAISGHEGINKDKDDEGSTINPTIT
IEAQDQIKKAVISQSDVLARMTIEEHEQDGEKTYQYVLNAEPSNLFETKIRHSSNIKINN
KRFINPSINDVVQAIRNGN
NT seq 780 nt   +upstreamnt  +downstreamnt
atgactgaaaaaactaatcaagatgtcgatattttaacgcaactaggtgtaaaagacatc
agcaaacaaaatgcaaacaagttttataaatttgcgatatacggcaagttcggtactggt
aaaactacgtttttaacaaaagataacaatgccttagtactagatataaatgaggacgga
acaacggtaacagaagatggggcagttgtgcagattaagaattataagcattttagtgca
gtgattaaaatgctgcctaaaattattgaacaactaagagaaaacggaaaacaaattgat
gttgtagtgattgaaacaatccaaaagttacgtgatatcactatggacgacatcatggac
ggtaaatcaaagaaaccgacatttaatgattggggcgagtgtgctacacgcattgtaagt
atttatcgttatatttctaaattacaagaacattatcaatttcatcttgctataagcgga
cacgagggcattaacaaagacaaagatgatgagggaagtactatcaatccaacaatcacg
atagaggcacaagaccaaataaaaaaagcagtcatcagtcaatctgacgtgttagcaaga
atgacaatagaagaacatgagcaagacggcgaaaaaacttatcaatatgtacttaacgct
gaaccatcaaatttattcgagacaaagataagacactcaagcaacatcaaaattaacaac
aaacgtttcattaatccaagtattaacgatgttgtacaagcaattagaaatggtaattaa

DBGET integrated database retrieval system