KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02073
Entry
SAOUHSC_02073     CDS       T00324                                 

Name
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: Phage_Mu_Gam Glyco_hydro_17 CCDC84 Sipho_Gp157
Other DBs
NCBI-GeneID: 3919760
NCBI-ProteinID: YP_500566
UniProt: A0A7Z7KE07 Q2FX32
Position
complement(1959447..1959983)
AA seq 178 aa
MNDLQERELETFEQDDRFKVTDLDSANWVFKKLDAITTKENEINDLANKEIERINEWKDK
EVEKLQSGKEYLQSLVIEYYRIQKEQDSKFKLNTPYGKVTARKGSKVIQVSNEQEVIKQL
EQRGFDNYVKVTKKLSQSDIKKDFNVTENGTLIDANGEVLEGASIVEKPTSYTVKVGE
NT seq 537 nt   +upstreamnt  +downstreamnt
gtgaatgatttacaagagagagaattagaaacattcgaacaagacgaccgattcaaagta
actgatctagacagtgctaactgggtttttaagaaactggatgcaatcacaactaaagag
aatgaaatcaacgatttagcaaataaagaaattgaacgcataaacgaatggaaagataaa
gaagtagaaaaattacagagtggcaaagaatatttacaaagccttgtaattgaatattac
agaatacaaaaagaacaagatagcaaattcaagttgaatacaccttacggaaaagtgaca
gccagaaaaggttcaaaagtcattcaagttagcaatgagcaagaagtcattaaacaactt
gagcaacgaggttttgacaactatgtaaaagtaactaaaaaacttagccaatcagacatt
aagaaagatttcaatgtaactgaaaacggcacattgattgacgcaaacggcgaagtttta
gagggtgctagcattgtggagaaaccaacgtcatacacggtaaaggtgggagaatag

DBGET integrated database retrieval system