KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02080
Entry
SAOUHSC_02080     CDS       T00324                                 

Name
(RefSeq) bacteriophage L54a antirepressor
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: ANT Bro-N P22_AR_N PBECR2
Other DBs
NCBI-GeneID: 3919767
NCBI-ProteinID: YP_500573
UniProt: A0A7Z7KGM5 Q2FX25
Position
complement(1961761..1962552)
AA seq 263 aa
MQALQTFNFKELPVRTVEIENEPYFVGKDIAEILGYARSDNAIRNHVDSEDKLTHQFSAS
GQNRNMIIINESGLYSLIFDASKQSKNEKIRETARKFKRWVTSDVLPAIRKHGIYATDNV
IEQTLKDPDYIITVLTEYKKEKEQNLLLQQEIGELKPKADYVDEILKSTGTLATTQIAAD
YGISAQKLNKLLHEARLQRKVNKQWVLYSEHMGKSYTDSDTITIVRSDGREDTVLQTRWT
QKGRLKIHEIMTEFGYEANLGGA
NT seq 792 nt   +upstreamnt  +downstreamnt
atgcaagcattacaaacatttaattttaaagagctaccagtaagaacagtagaaattgaa
aacgaaccttattttgtaggaaaagatattgctgagattttaggatatgcaagatcagac
aatgccattagaaatcatgttgatagcgaggacaaactgacgcaccaatttagtgcatca
ggtcaaaacagaaatatgatcattatcaacgaatcaggattatacagtctaatcttcgat
gcttctaaacaaagcaaaaacgaaaaaattagagaaaccgctagaaaattcaaacgctgg
gtaacatcagatgtcctaccagctattcgcaaacacggtatatacgcaacagacaatgta
attgaacaaacattaaaagatccagactacatcattacagtgttgactgagtataagaaa
gaaaaagagcaaaacttacttttacaacaagaaattggagagctaaaacccaaagcagat
tatgttgatgaaatcttaaaatcaactggcacattagccacaactcaaatcgcggcagac
tacggtatatcagcacaaaagttaaacaaactactacacgaagctagactacaacgaaaa
gtaaataaacagtgggtgctttactcagaacacatgggcaagagttacacagattcagac
actataacaattgtgcgttctgatggcagagaagacacagttttacaaactagatggaca
caaaaaggcagattgaaaatacatgaaatcatgactgaattcggttatgaagctaattta
gggggagcgtaa

DBGET integrated database retrieval system