KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02081
Entry
SAOUHSC_02081     CDS       T00324                                 

Name
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: ATG17_like APG6_N DUF4164 Prefoldin_2 Trns_repr_metal
Other DBs
NCBI-GeneID: 3919768
NCBI-ProteinID: YP_500574
UniProt: Q2FX24
Position
complement(1962709..1963017)
AA seq 102 aa
MQDQSLKLVKLQLKYHNLSGQIEAYDKSLKEIRYTRDLFNKHLSMNNEDAFAGLEMVEDE
ITKKLRSAIKEFQKVVKALDKLNGVESDNKVTDLTEWRKVNQ
NT seq 309 nt   +upstreamnt  +downstreamnt
atgcaagaccaatcattaaaattagtaaaactacaactaaaatatcataacctttcagga
caaattgaagcttatgataaatcacttaaagaaataagatacactcgagatcttttcaac
aaacatctaagcatgaataacgaagacgcatttgctggtttggaaatggtagaagatgaa
attactaaaaagctacgaagtgctatcaaagagttccaaaaagtagtgaaagcgttagac
aagcttaacggtgttgaaagcgataacaaagttactgatttaacagagtggcggaaagtg
aatcagtaa

DBGET integrated database retrieval system