KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02083
Entry
SAOUHSC_02083     CDS       T00324                                 

Name
(RefSeq) bacteriophage L54a Cro-like protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: HTH_3 HTH_19 Sigma70_r4 HTH_26 HTH_37
Other DBs
NCBI-GeneID: 3919769
NCBI-ProteinID: YP_500575
UniProt: A0A7Z7KF57 Q2FX23
Position
complement(1963032..1963250)
AA seq 72 aa
MQWNLIKLRKERKCTQEDLANLLNISTEGYRLKELGKHQFKNDEMFIIADFFDENIGDIF
LPTKYTKRKQTS
NT seq 219 nt   +upstreamnt  +downstreamnt
atgcaatggaatttaataaagttgagaaaagaaagaaagtgtactcaagaagatttagca
aacctcttgaatatatcaactgaaggttatcgtttaaaagaattaggaaagcatcaattt
aagaatgatgagatgtttattatcgctgatttttttgacgaaaatattggagatattttt
ttacccacaaagtacacgaaacgcaaacaaacatcttaa

DBGET integrated database retrieval system