KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02084
Entry
SAOUHSC_02084     CDS       T00324                                 

Definition
(RefSeq) phage repressor protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Motif
Pfam: Peptidase_S24 HTH_3 HTH_19 HTH_31 Pou HTH_26 HTH_37 MqsA_antitoxin
Other DBs
NCBI-GeneID: 3919770
NCBI-ProteinID: YP_500576
UniProt: Q2FX22
Position
1963392..1964111
AA seq 239 aa
MDKKELAKFIGNKIRYYRTKLNLTQDQLGEKLNTKKATISNYETGYRTPKQDDLFEIAHI
LNISIDDLFPTRNNKKNDITSIYNKLTPPRQENVLNYANEQLDEQNKVTSIDEYKESKLV
SYIACGATGAGIGEELYDDILHEEVFFKEDETPSNADFCILVNGDSMEPMLKQGTYAFIK
KEDSIKDGTIALVVLDGVSLIKRVDICEDYINLVSLNPKYDDIKVASFSNIKVMGKVVL
NT seq 720 nt   +upstreamnt  +downstreamnt
atggataaaaaagaattagcgaaatttataggcaataaaatcagatactatagaaccaaa
ttgaacttaactcaagatcaacttggagaaaaactcaacactaaaaaagctactatttca
aattatgagacagggtacagaactcctaaacaagatgatttgtttgaaattgctcatatt
ttaaatatcagtatcgatgatttgtttcctacaagaaataataaaaaaaacgacatcact
tccatatacaacaaactcacacctccccgccaagaaaacgtacttaactacgcaaatgag
caattagatgaacagaataaagtcacttctatagatgaatataaagagtctaaactagta
tcgtatattgcatgtggtgcaactggtgctggcataggagaagaattatatgatgacata
ttgcatgaagaagtattttttaaagaagacgaaacgccatcaaatgctgatttttgtatt
ttagttaatggtgattcaatggaacctatgttaaaacaaggaacatacgcttttattaag
aaagaagattctattaaagatggtacaattgcactcgttgtattagatggagtaagtctt
atcaagcgtgtagatatatgcgaagactatattaatttggtatctctaaatccgaagtat
gatgatatcaaagtcgcttcgtttagtaatattaaagtaatgggcaaagttgtattgtga

DBGET integrated database retrieval system