KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02085
Entry
SAOUHSC_02085     CDS       T00324                                 

Name
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Other DBs
NCBI-GeneID: 3919771
NCBI-ProteinID: YP_500577
UniProt: A0A7Z7P781 Q2FX21
Position
1964181..1964348
AA seq 55 aa
MKITNCKIKKETIVYEVLTSGNQPFTYELPKDLSSHNARKYLEFISQKIDGDKLN
NT seq 168 nt   +upstreamnt  +downstreamnt
atgaaaataactaattgcaaaataaaaaaagaaactatagtatatgaagttttaactagt
ggtaatcaaccattcacttatgagttacctaaagatttatcgtcacataatgcgcgtaaa
tacttggaatttatttcacaaaaaatagatggcgataagttaaattaa

DBGET integrated database retrieval system