KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02114
Entry
SAOUHSC_02114     CDS       T00324                                 

Definition
(RefSeq) lipid kinase
  KO
K07029  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00561  Glycerolipid metabolism
sao00564  Glycerophospholipid metabolism
sao01100  Metabolic pathways
sao01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAOUHSC_02114
   00564 Glycerophospholipid metabolism
    SAOUHSC_02114
Enzymes [BR:sao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     SAOUHSC_02114
SSDB
Motif
Pfam: DAGK_cat YegS_C NAD_kinase
Other DBs
NCBI-GeneID: 3921186
NCBI-ProteinID: YP_500606
UniProt: Q2FWZ2
Structure
PDB: 
2QV7 2QVL

Position
complement(1986589..1987536)
AA seq 315 aa
MRKRARIIYNPTSGKELFKRELPDALIKLEKAGYETSAYATEKIGDATLEAERAMHENYD
VLIAAGGDGTLNEVVNGIAEKPNRPKLGVIPMGTVNDFGRALHIPNDIMGALDVIIEGHS
TKVDIGKMNNRYFINLAAGGQLTQVSYETPSKLKSIVGPFAYYIKGFEMLPQMKAVDLRI
EYDGNVFQGEALLFFLGLTNSMAGFEKLVPDAKLDDGYFTLIIVEKSNLAELGHIMTLAS
RGEHTKHPKVIYEKAKAINISSFTDLQLNVDGEYGGKLPANFLNLERHIDVFAPNDIVNE
ELINNDHVDDNLIEE
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaggaaacgtgctagaatcatttataacccgacatcaggtaaagagctatttaaaaga
gaattacctgatgccttaataaaattagaaaaagcgggatatgaaacgagtgcatatgca
accgagaaaataggtgatgccacacttgaagcagaaagagctatgcatgaaaattatgat
gtattaatcgctgcaggtggtgatggaacattaaatgaagtagttaatggtatcgcagaa
aagcctaatcgtcctaagctaggtgtcattcctatgggtactgttaatgactttggacgt
gcattgcatatacctaatgacatcatgggggcacttgatgtcatcattgaaggtcattct
actaaagtagatattggtaaaatgaataatcgatactttattaatttagctgcaggcgga
caattgacgcaagtctcttatgaaacaccgagtaaattgaaatctattgttggtccattt
gcttattacatcaaaggtttcgaaatgttacctcaaatgaaagctgtagatttaagaatt
gaatatgatggtaatgttttccaaggagaagcattattattctttttaggtttaacaaat
tcaatggcaggatttgaaaaattagtgccggacgctaagttagatgacggctattttacg
ttaattatagttgaaaaatcaaaccttgcagaacttggtcatattatgactttagcttca
agaggagaacatactaagcatcctaaagttatttatgaaaaagcaaaggcaattaatatt
tcatcattcacagacttacaactaaatgtagatggagaatatggtggtaaattaccagcg
aatttcttaaatctagaacgtcatatagatgtctttgcacctaatgatattgtaaatgaa
gagttaataaataatgatcatgttgatgacaatttaatcgaagaataa

DBGET integrated database retrieval system