KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02540
Entry
SAOUHSC_02540     CDS       T00324                                 

Definition
(RefSeq) molybdopterin converting factor moa
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00790  Folate biosynthesis
sao01100  Metabolic pathways
sao01240  Biosynthesis of cofactors
sao04122  Sulfur relay system
Module
sao_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAOUHSC_02540
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SAOUHSC_02540
Enzymes [BR:sao01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     SAOUHSC_02540
SSDB
Motif
Pfam: MoaE AhpC-TSA
Other DBs
NCBI-GeneID: 3921129
NCBI-ProteinID: YP_501003
UniProt: Q2FVY2
Structure
PDB: 
2Q5W 2QIE

Position
complement(2337933..2338379)
AA seq 148 aa
MKQFEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKL
AQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVP
IWKKEIWEDGSKWQGHQKGNYEEAKREE
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaacaatttgaaatcgtgacagaaccgatacaaacagaacaatatcgtgaattcact
ataaatgaatatcaaggtgcagtagttgtttttaccggtcatgttcgcgaatggactaaa
ggcgtcaaaacggaatatttagaatatgaagcgtatattccaatggctgaaaagaaattg
gcacaaattggagatgaaataaatgaaaaatggcctggaacgataacgagtattgttcat
agaatagggccattacaaatttcagatatcgctgtattaattgcggtttcttcaccgcat
cgtaaagatgcctatcgagcaaatgaatatgcaattgagcgtataaaagaaattgttccg
atttggaaaaaagaaatttgggaagatggttcaaaatggcaagggcatcaaaaagggaat
tatgaagaagcaaagagggaggaataa

DBGET integrated database retrieval system