KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02625
Entry
SAOUHSC_02625     CDS       T00324                                 
Name
(RefSeq) hypothetical protein
  KO
K07107  acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Brite
KEGG Orthology (KO) [BR:sao00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SAOUHSC_02625
Enzymes [BR:sao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-
     SAOUHSC_02625
SSDB
Motif
Pfam: 4HBT_2 4HBT
Other DBs
NCBI-GeneID: 3921402
NCBI-ProteinID: YP_501086
UniProt: Q2FVR7
Position
2413824..2414315
AA seq 163 aa
MVIIKQLFTHTQTVTSEFIDHNNHMHDANYNIIFSDVVNRFNYSHGLSLKERENLAYTLF
TLEEHTTYLSELSLGDVFTVTLYIYDYDYKRLHLFLTLTKEDGTLASTNEVMMMGINQHT
RRSDAFPESFSTQIAHYYKNQSTITWPEQLGHKIAIPHKGALK
NT seq 492 nt   +upstreamnt  +downstreamnt
atggttattatcaaacaactttttacacatactcaaaccgtaacatctgaattcattgac
cataacaatcatatgcatgatgcaaattataatatcatttttagtgacgtcgtgaatcgt
tttaattacagccacggtctttctttaaaagaacgcgaaaatttagcatatacgctattt
acactagaagaacatacgacatacctctcagaattgtctcttggcgatgtatttactgtt
actttatatatttatgattacgattataagcggttgcatttatttttaacattaactaaa
gaagatggtacactagcatcaacaaatgaagtaatgatgatgggaattaatcagcacaca
cgtcgttctgatgcttttcctgaatcattttcaacacaaatagcacactattataaaaat
caatcaactatcacttggcctgaacaattaggacataaaatagcaattccacacaaagga
gcattaaaatga

DBGET integrated database retrieval system