KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02626
Entry
SAOUHSC_02626     CDS       T00324                                 
Name
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: PRP9_N DUF3567 LMP COOH-NH2_lig MSP7_C
Other DBs
NCBI-GeneID: 3921403
NCBI-ProteinID: YP_501087
UniProt: Q2G2W6
Position
2414312..2414731
AA seq 139 aa
MTDALQQKIHIELLDLLDDVKFELTELNAQKGLYINGPANQLLKRGVHMAYVQGQKQAID
NIMTIVEQQLEDQHFLEHYDKFQNEVAHRNYDKTANFAELSDIPRQFDNFLDQFYQIKGQ
YFIITHINTLIGDFHSEAH
NT seq 420 nt   +upstreamnt  +downstreamnt
atgacagatgcattacaacaaaagattcatatcgaattactagatttattagatgatgtt
aagtttgaattaacagaattaaatgcacaaaaagggttatacattaacggaccagcaaat
cagctacttaagcgtggcgtgcatatggcttatgttcaaggacaaaagcaagccatcgat
aatattatgactattgtggaacaacagcttgaagatcaacatttcctagaacattatgat
aaatttcaaaatgaggttgctcatcgcaattatgataaaacagctaactttgcagaactt
agtgatattccacgtcaattcgataattttttagatcaattttatcaaattaaagggcaa
tactttatcatcacacatatcaatacacttattggtgattttcactcagaagctcattaa

DBGET integrated database retrieval system