KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02630
Entry
SAOUHSC_02630     CDS       T00324                                 
Name
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl HlyD_2 CusB_dom_1 DUF6672 DUF2118 PASTA Peptidase_M23 DUF3221 SurA_N_3
Other DBs
NCBI-GeneID: 3921407
NCBI-ProteinID: YP_501091
UniProt: Q2G2W5
Position
complement(2418795..2419442)
AA seq 215 aa
MKKMILINVITVVVLLAIGIAGFYFWNKTTSYVTTDNAKVNGDQIKIASPASGQIKSLNV
KQGDKLDKGDKVAIVTVQGQDGETKDMDLKMPQKGTIAKLDGMEGSMVQAGNPIAYAYNL
DDLYVTANIDEKDIKDVEVGKDVDVTIDGQKASIKGKVDSIGKATAASFSLMPSSNSDGN
YTKVSQVIPVKITLESEPSKQVVPGMNAEVKIHKN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaaaaagatgatattaattaatgtcattacggttgttgtactgttagcaattgggatt
gctggcttttatttttggaataaaacaacaagctatgtaacaactgataatgcaaaagta
aatggcgatcaaattaaaatagcaagtcctgcatctggacaaattaaatcacttaatgtt
aaacaaggtgacaaactcgataaaggtgacaaagtagcaattgttactgtacaaggtcaa
gatggcgaaacgaaagatatggatcttaaaatgcctcaaaaaggtacaattgccaaatta
gatggtatggaaggttcaatggtgcaagctggtaacccaatcgcttatgcatacaattta
gatgatttatatgtaacagcaaatattgacgaaaaagatattaaagatgttgaagtaggt
aaagatgttgatgtgactattgacggtcaaaaagcttctattaaaggtaaagttgatagt
attggaaaagcaactgctgcaagcttttcattaatgccatcatcaaatagtgatggtaac
tacactaaagtttctcaagtaatacctgttaaaatcactctagaatcagaaccgtctaaa
caagttgttcctggaatgaacgctgaagtaaaaatccataaaaattaa

DBGET integrated database retrieval system