KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02631
Entry
SAOUHSC_02631     CDS       T00324                                 
Name
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: TetR_C_8 TetR_N HTH_Tnp_1_2 HTH_23
Other DBs
NCBI-GeneID: 3921408
NCBI-ProteinID: YP_501092
UniProt: Q2G2W4
Position
2419563..2420114
AA seq 183 aa
MKRQAKIEIQNALVDLMAEYPFQEISTKMICAYCNINRSTFYDYYKDKFDLLDTINSKHK
EKFQFLLSALHHNFENIKQDKLKLYKFFIIIAKYIKHNEQFFKDILVTYPMKTLFIDYIN
LARDYYQQIMNDYSTTVTNKQLYVTYIIGGQAGVFINWLSNGCNESPEEVADILLANTIK
LQN
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaaacgacaagccaaaatagaaattcaaaacgcacttgttgatttgatggctgaatat
ccttttcaagaaatatccactaaaatgatttgcgcgtattgtaatattaatcgttctact
ttttatgattattacaaagataaatttgatttattggataccatcaactcaaagcataag
gaaaaattccaatttcttctaagcgcgctacatcataatttcgaaaatattaaacaggat
aagcttaaactttataaattcttcattattattgctaagtatatcaagcacaatgagcag
tttttcaaagacattttagttacctatccaatgaaaacattattcatagactatataaat
ttagcgagagattactatcaacaaattatgaatgactatagtactacagtaaccaataaa
cagctttatgttacatatatcataggcggtcaagctggggtgtttattaattggctttcg
aatggttgtaatgaatcacctgaagaagttgctgacattttattggctaatacgattaaa
cttcaaaactaa

DBGET integrated database retrieval system