KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02699
Entry
SAOUHSC_02699     CDS       T00324                                 

Definition
(RefSeq) hypothetical protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao02010  ABC transporters
sao02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:sao00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SAOUHSC_02699
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    SAOUHSC_02699
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sao02000]
    SAOUHSC_02699
   02035 Bacterial motility proteins [BR:sao02035]
    SAOUHSC_02699
Transporters [BR:sao02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    SAOUHSC_02699
Bacterial motility proteins [BR:sao02035]
 Flagellar system
  Flagellar assembly proteins
   Others
    SAOUHSC_02699
SSDB
Motif
Pfam: SBP_bac_3 Phosphonate-bd Lig_chan-Glu_bd InPase NMT1 SspK
Other DBs
NCBI-GeneID: 3919718
NCBI-ProteinID: YP_501161
UniProt: Q2FVL2
Position
complement(2481981..2482760)
AA seq 259 aa
MKRLLFVMIAFVFILAACGNNSSKDKEASKDSKTINVGTEGTYAPFSFHDKDGKLTGYDI
DVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSS
AVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRV
DGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEEN
GELAKIGKKWFGQDVSKSK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaaaagacttttatttgtgatgatagctttcgttttcatattggctgcatgcggaaac
aattcgtcgaaagacaaggaagctagtaaagatagcaagacaattaatgttgggactgag
gggacttatgcaccatttagtttccacgataaagatggtaaattaactggttacgatatt
gatgttattaaagcagtggctaaagaagaaggtttaaaacttaaatttaatgaaacttct
tgggattctatgtttgcaggtttagacgcagggcgttttgatgtaatcgcgaaccaagta
ggtattaatcctgatagagaaaagaaatataaattttctaagccttacacattctcaagt
gctgttttagttattcgtgaaaatgaaaaagatattaaagattttgatgatgttaaaggt
aagaagttagcacaaacattcacatctaattatggtaaattagctaaggataaaggtgct
gatattacaaaagttgatggctttaaccaatcaatggatttattattgtctaagcgtgtt
gatggtacatttaatgatagtctgtcatacttggattataaaaaacaaaaacctaatgct
aagatcaaagcaatcaaaggtaatgctgaacaaagtagatctgcatttgcattttctaaa
aaagcagatgatgaaacagttcaaaaattcaatgatggcttgaaaaaaatcgaggaaaac
ggtgaattagctaaaataggtaagaaatggtttggtcaagatgtttctaaatctaaatag

DBGET integrated database retrieval system