KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02983
Entry
SAOUHSC_02983     CDS       T00324                                 

Name
(RefSeq) accessory Sec system glycosylation chaperone GtfB
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: DUF6365
Other DBs
NCBI-GeneID: 3921465
NCBI-ProteinID: YP_501432
UniProt: A0A2X3YZP4 Q2FUW8
Position
complement(2749272..2750630)
AA seq 452 aa
MIKLFDYFNDHSRKLYESFKASKLEEDLTIVLNDNGFLPDDVISPYQFFADNHNTENMKP
RFFNQVTVPAFWEIKGNNNSATINDMGRLRGKIFYQSGERPRIVSRVEWFDDQQRVRFVD
YYSKNGIKFAQTVYDLNRKAILKKYMTAEGKEVIYENFVTSDVILDWQGKSYFFPSKLAF
ALFFIKQLEITEHHFVINSLALPFSVLYNLPSKGSDVLVWQEHCNGNVPGNMQLMCKGDM
KRHCNIIIPDKNEYETMLNIADAKVQSRILQGGYLYNYRSRNRYTKEIVILTNSDQLRNI
KVLVETLPDFKFHIAAITEMSDKLMQLDQYANVHLYPSINIDRVNELYQLCDIYLDINEG
NEILNAVEQAFDYELLILGYRQTAHHAKVTLSEHLFEHNDEITMESKDQLIQMLESLKDQ
QQFRDALLAQKAHAHEISREQFEQVFKQALES
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgattaaattatttgattactttaacgatcattcacgaaagttatatgagtcttttaaa
gccagtaagttggaagaagatttaacaattgtactcaatgacaatggctttttaccggac
gatgttatatcaccgtatcaattttttgcagataatcataatacagaaaatatgaaacca
cgattttttaatcaggttactgtaccagctttttgggaaattaaaggtaacaacaattcg
gctacaattaatgatatgggacgtctacgaggtaaaatattttatcaaagtggagagcgc
cctagaattgttagtcgtgtcgaatggtttgatgaccaacaacgtgtccgatttgtcgat
tattattctaagaatggtattaaatttgcacaaactgtttacgatttaaatcgtaaagcg
atcttgaagaaatatatgacagcagaaggtaaagaagtgatttatgaaaattttgtaaca
tctgatgtcatattggattggcaagggaagtcttactttttcccttcaaagctcgcattc
gcattattttttatcaagcaacttgaaattacggaacatcatttcgttattaactcacta
gccctaccattttcagtgttatataatttgccatcaaaaggtagtgatgttttggtatgg
caagaacactgtaatggtaatgtcccgggaaatatgcaattgatgtgtaaaggtgatatg
aaacgacattgtaatattattattccagataaaaacgaatatgaaacgatgctcaatata
gcagacgcaaaggttcaatctcgtattttacaaggcggatatctatataactatcgtagt
cgtaatagatatactaaagaaattgtaatattaactaactcggatcaacttcgtaacatc
aaggtattggttgaaactttaccagattttaagtttcacatcgctgctattacagagatg
tctgataagctaatgcaacttgatcaatatgctaatgtgcatttatacccatctattaat
attgacagggtaaatgaactataccagttatgtgatatttatcttgatatcaatgagggt
aatgaaattttaaatgcggtggaacaagcgtttgactatgagttgttgattttaggttat
cgtcaaaccgcacaccatgctaaagtaacattatcagagcacttatttgagcataatgat
gagataacaatggaaagtaaagaccaattaatacaaatgttagaaagtttgaaagatcaa
caacagtttcgagatgctttattagcacaaaaagcacatgcacacgaaatctcgcgtgaa
caattcgagcaagtttttaaacaggcgctcgaaagctaa

DBGET integrated database retrieval system