KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_03018
Entry
SAOUHSC_03018     CDS       T00324                                 

Name
(RefSeq) hypothetical protein
  KO
K16785  energy-coupling factor transport system permease protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sao00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SAOUHSC_03018
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sao02000]
    SAOUHSC_03018
Transporters [BR:sao02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    SAOUHSC_03018
SSDB
Motif
Pfam: CbiQ DUF5762 PDR_CDR
Other DBs
NCBI-GeneID: 3921285
NCBI-ProteinID: YP_501467
UniProt: A0A2X3Z1Y8 Q2FUT3
Position
complement(2791188..2792021)
AA seq 277 aa
MNQYNTIGFHPGNSRIHQLNATVKLLFLLVVSISAMVTYDTRYLILISASSILLVKYAHI
EWKQVRFVVKFILFFTILNIIAVYIFDPEYGVKIYNQRTELVNGIGRFTLTSQELFYLFN
LILKYISTVPLALIFLFTTNPSHFAASLNQLGVNYKISYAVSLALRYIPDIQETYFNISQ
AQQARGYDNSKKAKFTSRVKGIKRIVLPLIFSSIERIDTISTAMELRQFGQYKRRTWYVK
KQLKKDDYVVLCLTLILLMLVVTLFFLNNSRYFNPWH
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaatcaatataatactataggttttcacccgggaaatagtcgtattcatcaattaaat
gcgactgttaaacttttattcttattagttgtttctatttctgcaatggtgacttatgac
acaagatatttaattttaattagtgcttcatctattttattggtcaaatatgctcatatt
gaatggaaacaagttcgctttgttgttaaattcattctgtttttcacaatattaaatatt
attgccgtgtacatatttgaccctgaatatggtgtgaagatttataatcagcgtacagag
ttagtcaatggtattggtcgatttacgctaacatcacaggaattattctatctttttaat
ctaatattaaaatatattagtacagttcctttagcgttaatatttttattcacaacgaat
ccgagtcattttgctgcaagtttaaatcagctaggtgtgaattataaaatcagttacgca
gtctcactagcattaaggtatattccagatattcaagaaacatattttaatatttcacaa
gcgcaacaagcaagaggatatgataattcgaaaaaagcaaaatttactagccgtgttaaa
ggtatcaaacgcattgtgttacctttaatattttctagtatcgaaagaattgacactatt
agtactgctatggagttaagacaattcggacagtataaaaggagaacctggtacgtcaaa
aaacaattaaaaaaagatgattatgttgttttgtgtttgacgttaatacttctgatgtta
gtagttacattattctttttaaataatagtcgatatttcaacccgtggcattag

DBGET integrated database retrieval system