KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00461Help
Entry
SAOUHSC_00461     CDS       T00324                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00450  Selenocompound metabolism
sao00970  Aminoacyl-tRNA biosynthesis
sao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SAOUHSC_00461
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAOUHSC_00461
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sao01007]
    SAOUHSC_00461
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sao03016]
    SAOUHSC_00461
Enzymes [BR:sao01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SAOUHSC_00461
Amino acid related enzymes [BR:sao01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SAOUHSC_00461
Transfer RNA biogenesis [BR:sao03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SAOUHSC_00461
 Prokaryotic type
   Other AARSs
    SAOUHSC_00461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1d ARL2_Bind_BART PilM T4_neck-protein
Motif
Other DBs
NCBI-GeneID: 3920321
NCBI-ProteinID: YP_499040
UniProt: Q2G1R9
Structure
PDB: 

Position
461717..463690
Genome map
AA seq 657 aa AA seqDB search
MAKETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEK
AQKAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYL
GEYEGWYSVPDETYYTESQLVDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTDR
LLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNWGVHVPSNPKHVVYVWIDA
LVNYISALGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHG
WILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFDL
ANDLGNLVNRTISMVNKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSVA
LSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAPK
EIFEQLNINNPQFMEFSSLEQYGVLNESIMVTGQPKPIFPRLDSEAEIAYIKESMQPPAT
KEEKEEIPSKPQIDIKDFDKVEIKAATIIDAEHVKKSDKLLKIQVDLDSEQRQIVSGIAK
FYTPDDIIGKKVAVVTNLKPAKLMGQKSEGMILSAEKDGVLTLVSLPSAIPNGAVIK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaacattttatataacaaccccaatatactatcctagtgggaatttacat
ataggacatgcatattctacagtggctggagatgttattgcaagatataagagaatgcaa
ggatatgatgttcgctatttgactggaacggatgaacacggtcaaaaaattcaagaaaaa
gctcaaaaagctggtaagacagaaattgaatatttggatgagatgattgctggaattaaa
caattgtgggctaagcttgaaatttcaaatgatgattttatcagaacaactgaagaacgt
cataaacatgtcgttgagcaagtgtttgaacgtttattaaagcaaggtgatatctattta
ggtgaatatgaaggttggtattctgttccggatgaaacatactatacagagtcacaatta
gtagacccacaatacgaaaacggtaaaattattggtggcaaaagtccagattctggacac
gaagttgaactagttaaagaagaaagttatttctttaatattagtaaatatacagaccgt
ttattagagttctatgaccaaaatccagattttatacaaccaccatcaagaaaaaatgaa
atgattaacaacttcattaaaccaggacttgctgatttagctgtttctcgtacatcattt
aactggggtgtccatgttccgtctaatccaaaacatgttgtttatgtttggattgatgcg
ttagttaactatatttcagcattaggctatttatcagatgatgagtcactatttaacaaa
tactggccagcagatattcatttaatggctaaggaaattgtgcgattccactcaattatt
tggcctattttattgatggcattagacttaccgttacctaaaaaagtctttgcacatggt
tggattttgatgaaagatggaaaaatgagtaaatctaaaggtaatgtcgtagaccctaat
attttaattgatcgctatggtttagatgctacacgttattatctaatgcgtgaattacca
tttggttcagatggcgtatttacacctgaagcatttgttgagcgtacaaatttcgatcta
gcaaatgacttaggtaacttagtaaaccgtacgatttctatggttaataagtactttgat
ggcgaattaccagcgtatcaaggtccacttcatgaattagatgaagaaatggaagctatg
gctttagaaacagtgaaaagctacactgaaagcatggaaagtttgcaattttctgtggca
ttatctacggtatggaagtttattagtagaacgaataagtatattgacgaaacaacgcct
tgggtattagctaaggacgatagccaaaaagatatgttaggcaatgtaatggctcactta
gttgaaaatattcgttatgcagctgtattattacgtccattcttaacacatgcgccgaaa
gagatttttgaacaattgaacattaacaatcctcaatttatggaatttagtagtttagag
caatatggtgtgcttaatgagtcaattatggttactgggcaacctaaacctattttccca
agattggatagcgaagcggaaattgcatatatcaaagaatcaatgcaaccgcctgctact
aaagaggaaaaagaagagattcctagcaaacctcaaattgatattaaagactttgataaa
gttgaaattaaggcagcaacgattattgatgctgaacatgttaagaagtcagataagctt
ttaaaaattcaagtagacttagattctgaacaaagacaaattgtatcaggaattgccaaa
ttctatacaccagatgatattattggtaaaaaagtagcagttgttactaacctgaaacca
gctaaattaatgggacaaaaatctgaaggtatgatattatctgctgaaaaagatggtgta
ttaaccttagtaagtttaccaagtgcaattccaaatggtgcagtgattaaataa

DBGET integrated database retrieval system