KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00634Help
Entry
SAOUHSC_00634     CDS       T00324                                 

Definition
(RefSeq) ABC transporter substrate-binding protein
  KO
K19975  manganese/zinc transport system substrate-binding protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao02010  ABC transporters
Module
sao_M00792  Manganese/zinc transport system
Brite
KEGG Orthology (KO) [BR:sao00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SAOUHSC_00634
Transporters [BR:sao02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/zinc transporter [MD:M00792] [OT]
    SAOUHSC_00634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZnuA MRP-S28 Nit_Regul_Hom eIF3_N DUF1454
Motif
Other DBs
NCBI-GeneID: 3920043
NCBI-ProteinID: YP_499195
UniProt: Q2G2D8
Structure
PDB: 

Position
complement(624572..625510)
Genome map
AA seq 312 aa AA seqDB search
MKKLVPLLLALLLLVAACGTGGKQSSDKSNGKLKVVTTNSILYDMAKNVGGDNVDIHSIV
PVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSK
DVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQ
LEKLNNDSKDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQM
RQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMM
KSNIETVHGSMK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagtacctttattattagccttattacttctagttgctgcatgtggtact
ggtggtaaacaaagcagtgataagtcaaatggcaaattaaaagtagtaacgacgaattca
attttatatgatatggctaaaaatgttggtggagacaacgtcgatattcatagtattgta
cctgttggtcaagatcctcatgaatatgaagttaaacctaaagatattaaaaagttaact
gacgctgacgttattttatacaacggattaaatttagagactggtaacggttggtttgaa
aaagccttagaacaggctggtaaatcattaaaagataaaaaagttatcgcagtatcaaaa
gatgttaaacctatctatttaaacggtgaagaaggcaacaaagataaacaagatccacac
gcatggttaagtttagataacggtattaaatacgtaaaaacaattcaacaaacatttatc
gataacgacaaaaaacataaagcagattatgaaaagcaaggtaacaaatacattgctcaa
ttggaaaaattaaataatgacagtaaagacagtaaagacaaatttaatgacattccaaaa
gaacaacgtgccatgattacaagtgaaggtgccttcaagtacttctcaaaacaatacggt
attacaccaggttatatttgggaaattaacactgaaaaacaaggtacacctgaacaaatg
agacaagctattgagtttgttaaaaagcacaaattaaaacacttattagtagaaacaagt
gttgataagaaagcaatggaaagtttatctgaagaaacgaagaaagatatctttggtgaa
gtgtacacagattcaatcggtaaagaaggcactaaaggtgactcttactacaaaatgatg
aaatcaaatattgaaactgtacacggaagcatgaaataa

DBGET integrated database retrieval system