KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00680
Entry
SAOUHSC_00680     CDS       T00324                                 

Definition
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Other DBs
NCBI-GeneID: 3919443
NCBI-ProteinID: YP_499239
UniProt: Q2G0C5
Position
668104..668199
AA seq 31 aa
MVANAPTAKEPLINKLKGDKGIQLVANAPTA
NT seq 96 nt   +upstreamnt  +downstreamnt
ttggttgctaatgcaccaacagcaaaagagcccctaattaataaattaaaaggggacaaa
ggaatacagttggttgctaatgcaccaactgcataa

DBGET integrated database retrieval system