KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00869Help
Entry
SAOUHSC_00869     CDS       T00324                                 

Definition
(RefSeq) D-alanine--poly(phosphoribitol) ligase subunit 1
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00473  D-Alanine metabolism
sao01100  Metabolic pathways
sao01503  Cationic antimicrobial peptide (CAMP) resistance
sao02020  Two-component system
sao05150  Staphylococcus aureus infection
Module
sao_M00725  Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SAOUHSC_00869
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAOUHSC_00869
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    SAOUHSC_00869
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SAOUHSC_00869
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:sao01504]
    SAOUHSC_00869
Enzymes [BR:sao01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     SAOUHSC_00869
Antimicrobial resistance genes [BR:sao01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    SAOUHSC_00869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C NIR_SIR
Motif
Other DBs
NCBI-GeneID: 3919216
NCBI-ProteinID: YP_499422
UniProt: Q2FZW6
Position
834275..835732
Genome map
AA seq 485 aa AA seqDB search
MTDIINKLQAFADANPQSIAVRHTTDELTYQQLMDESSKLAHRLQGSKKPMILFGHMSPY
MIVGMIGAIKAGCGYVPVDTSIPEDRIKMIINKVQPEFVFNTTDESFESLEGEVFTIEDI
KTSQDPVIFDSQIKDNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELNKSGNEQQW
LNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMINKPKLLNEMLTATPINIWVSTPSFMEM
CLLLPTLNEEQYGSLNEFFFCGEILPHRAAKALVNRFPSATIYNTYGPTEATVAVTSIQI
TQEILDQYPTLPVGVERPGARLSTTDEGELVIEGQSVSLGYLKNDQKTAEVFNFDDGIRT
YHTGDKAKFENGQWFIQGRIDFQIKLNGYRMELEEIETQLRQSEFVKEAIVVPVYKNDKV
IHLIGAIVPTTEVTDNAEMTKNIKNDLKSRLPEYMIPRKFEWMEQLPLTSNGKIDRKKIA
EVING
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacagatattattaacaagctgcaagcgtttgcggatgcaaatccacaaagcattgct
gttagacacacaactgatgaattaacttatcaacagttaatggatgagtctagtaaatta
gcacatcgattacaaggtagtaagaaaccgatgattttattcggtcacatgtcaccatat
atgattgttgggatgattggtgccattaaagcaggatgtggatatgtacctgtagacact
tcaattcctgaagaccgtattaaaatgattattaacaaggttcaaccagagtttgtattt
aatacgactgatgaatcatttgaaagtttagaaggcgaagtatttacaatagaagatatt
aaaacatctcaagacccagtaatttttgatagtcagattaaagataacgacacagtatac
acaatctttacatctggttctactggggaacctaaaggtgttcaaattgaatatgcaagt
ttagttcaatttactgagtggatgttagaacttaataaatcaggaaatgaacaacaatgg
cttaaccaagcgccattttcatttgatttatctgtaatggctatttatccatgtttagca
tcaggcggtacattaaatcttgtagataaaaacatgattaataaacctaaattattaaat
gaaatgctaacagcaacaccgattaacatttgggtatcaacaccatcatttatggaaatg
tgtttattattaccaacgcttaatgaagaacaatatggtagtcttaacgaattcttcttc
tgtggtgaaattctacctcacagagcagcaaaagcgttagtaaaccgtttcccaagtgcg
acgatttacaacacatatggtccaactgaagctacggtagcagttacaagtattcaaatt
acacaagaaatcttagatcaatatccgacattacctgttggcgttgaaagaccaggcgca
agattatctactacagatgaaggtgaacttgttatcgaaggtcaaagtgtaagtttagga
tacttaaaaaatgaccaaaaaacagctgaagtatttaatttcgatgacggtattcgtaca
tatcacactggtgataaagcgaagtttgaaaatggtcaatggttcattcaaggtcgtatt
gatttccaaatcaaattgaatggctacagaatggaattagaagaaattgaaacacaatta
cgccagtctgagttcgtaaaagaagcgattgttgtacctgtatataaaaatgataaagtt
attcatttaattggtgcaattgtgccaacgactgaagttacggacaatgcagaaatgact
aaaaatattaaaaatgacttgaaatcacgcttaccagagtatatgattcctagaaagttt
gaatggatggaacaattgccattgacttcaaatggtaaaattgacagaaagaaaattgca
gaggtaattaacggatga

DBGET integrated database retrieval system