KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00954Help
Entry
SAOUHSC_00954     CDS       T00324                                 

Definition
(RefSeq) UDP-N-acetylmuramoylalanyl-D-glutamate--L-lysine ligase
  KO
K05362  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-L-lysine ligase [EC:6.3.2.7]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00550  Peptidoglycan biosynthesis
sao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAOUHSC_00954
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sao01011]
    SAOUHSC_00954
Enzymes [BR:sao01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.7  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---L-lysine ligase
     SAOUHSC_00954
Peptidoglycan biosynthesis and degradation proteins [BR:sao01011]
 Precursor biosynthesis
  Amino acid ligase
   SAOUHSC_00954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-GeneID: 3920665
NCBI-ProteinID: YP_499507
UniProt: Q2FZP6
Structure
PDB: 

Position
928483..929964
Genome map
AA seq 493 aa AA seqDB search
MDASTLFKKVKVKRVLGSLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQNVADQG
CKLVVVNKEQSLPANVTQVVVPDTLRVASILAHTLYDYPSHQLVTFGVTGTNGKTSIATM
IHLIQRKLQKNSAYLGTNGFQINETKTKGANTTPETVSLTKKIKEAVDAGAESMTLEVSS
HGLVLGRLRGVEFDVAIFSNLTQDHLDFHGTMEAYGHAKSLLFSQLGEDLSKEKYVVLNN
DDSFSEYLRTVTPYEVFSYGIDEEAQFMAKNIQESLQGVSFDFVTPFGTYPVKSPYVGKF
NISNIMAAMIAVWSKGTSLETIIKAVENLEPVEGRLEVLDPSLPIDLIIDYAHTADGMNK
LIDAVQPFVKQKLIFLVGMAGERDLTKTPEMGRVACRADYVIFTPDNPANDDPKMLTAEL
AKGATHQNYIEFDDRAEGIKHAIDIAEPGDTVVLASKGREPYQIMPGHIKVPHRDDLIGL
EAAYKKFGGGPVD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttggatgcaagtacgttgtttaagaaagtaaaagtaaagcgtgtattgggttctttagaa
caacaaatagatgatatcactactgattcacgtacagcgagagaaggtagcatttttgtc
gcttcagttggatatactgtagacagtcataagttctgtcaaaatgtagctgatcaaggg
tgtaagttggtagtggtcaataaagaacaatcattaccagctaacgtaacacaagtggtt
gtgccggacacattaagagtagctagtattctagcacacacattatatgattatccgagt
catcagttagtgacatttggtgtaacgggtacaaatggtaaaacttctattgcgacgatg
attcatttaattcaaagaaagttacaaaaaaatagtgcatatttaggaactaatggtttc
caaattaatgaaacaaagacaaaaggtgcaaatacgacaccagaaacagtttctttaact
aagaaaattaaagaagcagttgatgcaggcgctgaatctatgacattagaagtatcaagc
catggcttagtattaggacgactgcgaggcgttgaatttgacgttgcaatattttcaaat
ttaacacaagaccatttagattttcatggcacaatggaagcatacggacacgcgaagtct
ttattgtttagtcaattaggtgaagatttgtcgaaagaaaagtatgtcgtgttaaacaat
gacgattcattttctgagtatttaagaacagtgacgccttatgaagtatttagttatgga
attgatgaggaagcccaatttatggctaaaaatattcaagaatctttacaaggtgtcagc
tttgattttgtaacgccttttggaacttacccagtaaaatcgccttatgttggtaagttt
aatatttctaatattatggcggcaatgattgcggtgtggagtaaaggtacatctttagaa
acgattattaaagctgttgaaaatttagaacctgttgaagggcgattagaagttttagat
ccttcgttacctattgatttaattatcgattatgcacatacagctgatggtatgaacaaa
ttaatcgatgcagtacagccttttgtaaagcaaaagttgatatttttagttggtatggca
ggcgaacgtgatttaactaaaacgcctgaaatggggcgagttgcctgtcgtgcagattat
gtcattttcacaccggataatccggcaaatgatgacccgaaaatgttaacggcagaatta
gccaaaggtgcaacacatcaaaactatattgaatttgatgatcgtgcagaagggataaaa
catgcaattgacatagctgagcctggggatactgtcgttttagcatcaaaaggaagagaa
ccatatcaaatcatgccagggcatattaaggtgccacatcgagatgatttaattggcctt
gaagcagcttacaaaaagttcggtggtggccctgttgattaa

DBGET integrated database retrieval system