KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01111
Entry
SAOUHSC_01111     CDS       T00324                                 

Definition
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Other DBs
NCBI-GeneID: 3920753
NCBI-ProteinID: YP_499655
UniProt: Q2FZC1
Position
complement(1071183..1071275)
AA seq 30 aa
MLKTVKSTRLLGIKKHTELNSCTPNVRKQC
NT seq 93 nt   +upstreamnt  +downstreamnt
ttgttaaaaacggtgaaatcgactcgattacttggtattaaaaaacatactgaattaaat
agttgtacgccaaacgttagaaaacaatgctaa

DBGET integrated database retrieval system