KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01351Help
Entry
SAOUHSC_01351     CDS       T00324                                 

Definition
(RefSeq) DNA topoisomerase IV subunit B
  KO
K02622  topoisomerase IV subunit B [EC:5.6.2.2]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Brite
KEGG Orthology (KO) [BR:sao00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sao03032]
    SAOUHSC_01351
   03036 Chromosome and associated proteins [BR:sao03036]
    SAOUHSC_01351
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sao02048]
    SAOUHSC_01351
Enzymes [BR:sao01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     SAOUHSC_01351
DNA replication proteins [BR:sao03032]
 Prokaryotic type
  DNA Topoisomerases
   SAOUHSC_01351
Chromosome and associated proteins [BR:sao03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    SAOUHSC_01351
Prokaryotic defense system [BR:sao02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    SAOUHSC_01351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_gyraseB DNA_gyraseB_C HATPase_c Toprim HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 3920057
NCBI-ProteinID: YP_499879
UniProt: Q2FYS5
Structure
PDB: 

Position
1292206..1294197
Genome map
AA seq 663 aa AA seqDB search
MNKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGNEI
DVTINKDGSISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGA
SVVNALSEWLEVEIHRDGNIYHQSFKNGGSPSSGLVKKGKTKKTGTKVTFKPDDTIFKAS
TSFNFDVLSERLQESAFLLKNLKITLNDLRSGKERQEHYHYEEGIKEFVSYVNEGKEVLH
DVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDYAR
RINELKTKDKNLDGNDIREGLTAVVSVRIPEELLQFEGQTKSKLGTSEARSAVDSVVADK
LPFYLEEKGQLSKSLVKKAIKAQQAREAARKAREDARSGKKNKRKDTLLSGKLTPAQSKN
TEKNELYLVEGDSAGGSAKLGRDRKFQAILPLRGKVINTEKARLEDIFKNEEINTIIHTI
GAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKYMKPLVQAGRVFIALPPLY
KLEKGKGKTKRVEYAWTDEELNKLQKELGKGFTLQRYKGLGEMNPEQLWETTMNPETRTL
IRVQVEDEVRSSKRVTTLMGDKVQPRREWIEKHVEFGMQEDQSILDNSEVQVLENDQFDE
EEI
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaaaataattattcagatgattcaatacaggttttagaggggttagaagca
gttcgtaaaagacctggtatgtatattggatcaactgataaacggggattacatcatcta
gtatatgaaattgtcgataactccgtcgatgaagtattgaatggttacggtaacgaaata
gatgtaacaattaataaagatggtagtatttctatagaagataatggacgtggtatgcca
acaggtatacataaatcaggtaaaccgacagtcgaagttatctttactgttttacatgca
ggaggtaaatttggacaaggcggctataaaacttcaggtggtcttcacggtgttggtgct
tcagttgtaaatgcattgagtgaatggcttgaagttgaaatccatcgagatggtaatata
tatcatcaaagttttaaaaacggtggttcgccatcttctggtttagtgaaaaaaggtaaa
actaagaaaacaggtaccaaagtaacatttaaacctgatgacacaatttttaaagcatct
acatcatttaattttgatgttttaagtgaacgactacaagagtctgcgttcttattgaaa
aatttaaaaataacgcttaatgatttacgcagtggtaaagagcgtcaagagcattaccat
tatgaagaaggaatcaaagagtttgttagttatgtcaatgaaggaaaagaagttttgcat
gacgtggctacattttcaggtgaagcaaatggtatagaggtagacgtagctttccaatat
aatgatcaatattcagaaagtattttaagttttgtaaataatgtacgtactaaagatggt
ggtacacatgaagttggttttaaaacagcaatgacacgtgtatttaatgattatgcacgt
cgtattaatgaacttaaaacaaaagataaaaacttagatggtaatgatattcgtgaaggt
ttaacagctgttgtgtctgttcgtattccagaagaattattgcaatttgaaggacaaacg
aaatctaaattgggtacttctgaagctagaagtgctgttgattcagttgttgcagacaaa
ttgccattctatttagaagaaaaaggacaattgtctaaatcacttgtgaaaaaagcgatt
aaagcacaacaagcaagggaagctgcacgtaaagctcgtgaagatgctcgttcaggtaag
aaaaacaagcgtaaagacactttgctatctggtaaattaacacctgcacaaagtaaaaac
actgaaaaaaatgaattgtatttagtcgaaggtgattctgcgggaggttcagcaaaactt
ggacgagaccgcaaattccaagcgatattaccattacgtggtaaggtaattaatacagag
aaagcacgtctagaagatatttttaaaaatgaagaaattaatacaattatccacacaatc
ggggcaggcgttggtactgactttaaaattgaagatagtaattataatcgtgtaattatt
atgactgatgctgatactgatggtgcgcatattcaagtgctattgttaacattcttcttc
aaatatatgaaaccgcttgttcaagcaggtcgtgtatttattgctttacctccactttat
aaattggaaaaaggtaaaggcaaaacaaagcgagttgaatacgcttggacagacgaagag
cttaataaattgcaaaaagaacttggtaaaggcttcacgttacaacgttacaaaggtttg
ggtgaaatgaaccctgaacaattatgggaaacgacgatgaacccagaaacacgaacttta
attcgtgtacaagttgaagatgaagtgcgttcatctaaacgtgtaacaacattaatgggt
gacaaagtacaacctagacgtgaatggattgaaaagcatgttgagtttggtatgcaagag
gaccaaagtattttagataattctgaagtacaagtgcttgaaaatgatcaatttgatgag
gaggaaatctag

DBGET integrated database retrieval system