KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01603
Entry
SAOUHSC_01603     CDS       T00324                                 

Definition
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Other DBs
NCBI-GeneID: 3920019
NCBI-ProteinID: YP_500118
UniProt: Q2FY62
Position
complement(1528896..1529150)
AA seq 84 aa
MVNVYLIFKMAKVTILQLVTKQSILIFIQTFILIFGLNFSMKVLFLSFYAIVCTNLLTFL
ESVTKLVLYSGWKRFPMQKLTGGD
NT seq 255 nt   +upstreamnt  +downstreamnt
atggtcaacgtgtatttaattttcaagatggccaaggtaactattttgcagttagtgact
aaacaatcgattttaatatttatacaaacctttatattgattttcggattgaatttcagt
atgaaggttttatttttatcgttttatgcaatcgtttgcacaaatcttttgactttttta
gaaagtgtgactaaactggtattatacagtggttggaagcgttttccgatgcagaaatta
acaggaggtgattaa

DBGET integrated database retrieval system