KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01629Help
Entry
SAOUHSC_01629     CDS       T00324                                 

Definition
(RefSeq) hypothetical protein
  KO
K03800  lipoate---protein ligase [EC:6.3.1.20]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00785  Lipoic acid metabolism
sao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    SAOUHSC_01629
Enzymes [BR:sao01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.20  lipoate---protein ligase
     SAOUHSC_01629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_LplA_LipB
Motif
Other DBs
NCBI-GeneID: 3919967
NCBI-ProteinID: YP_500143
UniProt: Q2FY37
Position
complement(1550247..1551077)
Genome map
AA seq 276 aa AA seqDB search
MTETWNFINTGSKDPYYNMAMDEALLNFVSRGEIDPVIRFYTWNPATLSIGYFQRLQKEI
DIDKVKEKGFGLVRRQTGGRGVLHDKELTYSVIVPESHPNMPSTVTEAYRVISQGLLEGF
KNLGFDTYFAVPKTPEERQKLKQPRSSVCFDAPSWYELVVEGRKIAGSAQTRQKGVILQH
GSILQDIDIDELFDMFIYKNERLKLKMKEAFVEKAVAINDISDEHITISQMEEAFEKGFK
KGLNIELKPLELTEAQLAEVEELTEKYRSDEWMFRK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaacttggaattttattaatacaggaagtaaagacccatattataatatggca
atggatgaagcgttattaaattttgtctctagaggtgaaattgatccagttatacgtttt
tacacatggaatcctgcaacattatcaatagggtatttccaaaggctacaaaaagaaatt
gatattgataaggttaaagagaaaggttttggtctcgtaaggcgtcaaactggtggccgt
ggggtgctacatgataaagagttaacttacagtgtgattgtgcctgaatcgcatccgaat
atgccttctacagttacagaagcgtacagagtgatttcacaaggattattagaaggattt
aaaaacttaggatttgatacttattttgcggtacctaaaacgcctgaagagcgtcaaaaa
ttaaaacaacctcgaagttcagtgtgttttgatgcaccaagttggtatgagctagttgtt
gaaggccgtaagattgctgggagtgctcaaacgagacaaaagggcgtaatcctccaacac
ggttcgattttacaagatattgatattgatgaactgtttgatatgtttatttataaaaat
gaaagattaaaattaaaaatgaaagaggcattcgttgaaaaagcagttgccatcaatgat
atttcagatgaacacattactattagtcaaatggaagaagctttcgagaaaggttttaag
aaaggtttaaatatagaattaaagccacttgaattaacagaagctcaattggcagaagtg
gaagaattaactgaaaaatatcgttcagatgaatggatgtttagaaagtag

DBGET integrated database retrieval system