KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01839Help
Entry
SAOUHSC_01839     CDS       T00324                                 

Definition
(RefSeq) tyrosyl-tRNA synthetase
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sao00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAOUHSC_01839
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sao01007]
    SAOUHSC_01839
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sao03016]
    SAOUHSC_01839
   03029 Mitochondrial biogenesis [BR:sao03029]
    SAOUHSC_01839
Enzymes [BR:sao01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     SAOUHSC_01839
Amino acid related enzymes [BR:sao01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SAOUHSC_01839
Transfer RNA biogenesis [BR:sao03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SAOUHSC_01839
 Prokaryotic type
    SAOUHSC_01839
Mitochondrial biogenesis [BR:sao03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SAOUHSC_01839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1b S4
Motif
Other DBs
NCBI-GeneID: 3921789
NCBI-ProteinID: YP_500345
UniProt: Q2FXJ5
Structure
PDB: 

Position
complement(1744667..1745929)
Genome map
AA seq 420 aa AA seqDB search
MTNVLIEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRF
QEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFGTDHGAV
LVNNRDWLGQISLISFLRDYGKHVGVNYMLGKDSIQSRLEHGISYTEFTYTILQAIDFGH
LNRELNCKIQVGGSDQWGNITSGIELMRRMYGQTDAYGLTIPLVTKSDGKKFGKSESGAV
WLDAEKTSPYEFYQFWINQSDEDVIKFLKYFTFLGKEEIDRLEQSKNEAPHLREAQKTLA
EEVTKFIHGEDALNDAIRISQALFSGDLKSLSAKELKDGFKDVPQVTLSNDTTNIVEVLI
ETGISPSKRQAREDVNNGAIYINGERQQDVNYALAPEDKIDGEFTIIRRGKKKYFMVNYQ
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgtattaattgaagatttaaaatggagaggtcttatttatcaacaaactgat
gaacaaggtattgaagatttattaaataaagaacaagtgacgttatactgcggtgccgat
ccaacggcagatagtttacatattggtcacttactaccattcttaacattaagacgtttt
caagaacatggacatcgtcctatcgttttaattggcggtggtacaggtatgattggtgat
ccatcaggtaaatcagaagaacgtgtgctacaaacagaagaacaagtagataaaaatatc
gaaggtattagtaagcaaatgcacaatatttttgaatttggaacagaccatggtgcagtg
cttgttaataatagagactggttaggacaaatctcattaattagttttttacgtgactat
ggtaaacacgtcggcgttaattacatgttaggtaaagattcaatccaaagtcgtttagaa
catggtatttcatatacagaattcacatacacgattttacaagctattgatttcggtcat
ttgaatagagaattgaattgtaagattcaagtaggtggatcagatcaatggggtaatatc
acaagtggtattgaattaatgcgtcgtatgtatggtcaaacagacgcatacggtttaact
attccgcttgtaactaaatcagatggtaagaaatttggtaagtctgagtcaggtgctgtt
tggttagatgctgaaaaaacaagtccttatgaattttatcaattctggattaatcaatca
gacgaagatgtaattaaattcttaaaatactttactttcttaggaaaagaagaaattgat
cgcttagaacaatctaaaaatgaagcaccgcatttacgtgaagctcaaaaaacattagct
gaagaagtaactaaatttattcatggtgaagatgcattaaatgatgcaatccgtatttca
caagcattatttagtggtgatttaaaatcattatcagcgaaagaattaaaagatggattt
aaagatgtgcctcaagtgacattatcaaatgacacaacaaatatcgttgaagtccttatt
gaaacaggcatttctccttctaaacgacaagcacgtgaagatgttaacaatggtgcgatt
tatattaatggtgagagacaacaagatgttaattatgctttagcaccagaagataaaatt
gatggcgaatttacgattattcgtcgcggtaagaaaaaatacttcatggttaactatcaa
taa

DBGET integrated database retrieval system