KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02200
Entry
SAOUHSC_02200     CDS       T00324                                 

Definition
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: Elf4 Swi6_N SMP_2
Other DBs
NCBI-GeneID: 3919566
NCBI-ProteinID: YP_500685
UniProt: Q2FWT0
Position
complement(2058606..2059076)
AA seq 156 aa
MYNRKEIREMIDNYKWMKNIIDSKVYDNESTSIAQYGYQSAMPKAKGTTSNKVLVKVINK
NKALRKYDYLIKKIAFIDEYEEYITNEKDYHILQMLKQRESHNRIMSILDIGRDNFYSRV
KDIVNILYNLQQETDSSDTSYSSDTSYSSDTSYSSD
NT seq 471 nt   +upstreamnt  +downstreamnt
atgtataacaggaaagaaatacgtgaaatgatagataactacaagtggatgaagaacata
atagacagtaaagtctacgataacgaaagtacatcaattgcacaatatggttatcaatct
gcgatgccaaaagctaaaggcacgactagcaataaagtgttagtgaaagttataaacaaa
aacaaagcgcttagaaagtacgattacttgattaagaagatagcgttcattgatgaatat
gaagaatacatcacgaatgaaaaagattatcatattttacaaatgttaaaacaacgagaa
agccataataggatcatgagcattcttgatataggcagagacaatttttattctagagta
aaagatatagtaaatatactttataacttgcaacaagaaaccgacagttcggacacatcg
tacagttcggacacatcgtacagttcggacacatcgtacagttcggactaa

DBGET integrated database retrieval system