KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02366Help
Entry
SAOUHSC_02366     CDS       T00324                                 

Definition
(RefSeq) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00010  Glycolysis / Gluconeogenesis
sao00030  Pentose phosphate pathway
sao00051  Fructose and mannose metabolism
sao00680  Methane metabolism
sao01100  Metabolic pathways
sao01110  Biosynthesis of secondary metabolites
sao01120  Microbial metabolism in diverse environments
sao01130  Biosynthesis of antibiotics
sao01200  Carbon metabolism
sao01230  Biosynthesis of amino acids
Module
sao_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sao_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
sao_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAOUHSC_02366
   00030 Pentose phosphate pathway
    SAOUHSC_02366
   00051 Fructose and mannose metabolism
    SAOUHSC_02366
  09102 Energy metabolism
   00680 Methane metabolism
    SAOUHSC_02366
Enzymes [BR:sao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SAOUHSC_02366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-GeneID: 3919409
NCBI-ProteinID: YP_500842
UniProt: Q2FWD3
Structure
PDB: 

Position
complement(2188351..2189211)
Genome map
AA seq 286 aa AA seqDB search
MPLVSMKEMLIDAKENGYAVGQYNINNLEFTQAILEASQEENAPVILGVSEGAARYMSGF
YTIVKMVEGLMHDLNITIPVAIHLDHGSSFEKCKEAIDAGFTSVMIDASHSPFEENVATT
KKVVEYAHEKGVSVEAELGTVGGQEDDVVADGIIYADPKECQELVEKTGIDALAPALGSV
HGPYKGEPKLGFKEMEEIGLSTGLPLVLHGGTGIPTKDIQKAIPFGTAKINVNTENQIAS
AKAVRDVLNNDKEVYDPRKYLGPAREAIKETVKGKIKEFGTSNRAK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcctttagtttcaatgaaagaaatgttaattgatgcaaaagaaaatggttatgcggta
ggtcaatacaatattaataacctagaattcactcaagcaattttagaagcgtcacaagaa
gaaaatgcacctgtaattttaggtgtttctgaaggtgctgctcgttacatgagcggtttc
tacacaattgttaaaatggttgaagggttaatgcatgacttaaacatcactattcctgta
gcaatccatttagaccatggttcaagctttgaaaaatgtaaagaagctatcgatgctggt
ttcacatcagtaatgatcgatgcttcacacagcccattcgaagaaaacgtagcaacaact
aaaaaagttgttgaatacgctcatgaaaaaggtgtttctgtagaagctgaattaggtact
gttggtggacaagaagatgatgttgtagcagacggcatcatttatgctgatcctaaagaa
tgtcaagaactagttgaaaaaactggtattgatgcattagcgccagcattaggttcagtt
catggtccatacaaaggtgaaccaaaattaggatttaaagaaatggaagaaatcggttta
tctacaggtttaccattagtattacacggtggtactggtatcccgactaaagatatccaa
aaagcaattccatttggtacagctaaaattaacgtaaacactgaaaaccaaatcgcttca
gcaaaagcagttcgtgacgttttaaataacgacaaagaagtttacgatcctcgtaaatac
ttaggacctgcacgtgaagccatcaaagaaacagttaaaggtaaaattaaagagttcggt
acttctaaccgcgctaaataa

DBGET integrated database retrieval system