KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02462
Entry
SAOUHSC_02462     CDS       T00324                                 

Definition
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Other DBs
NCBI-GeneID: 3919025
NCBI-ProteinID: YP_500930
UniProt: Q2FW55
Position
2284713..2284880
AA seq 55 aa
MRKIWVIDCLYASTFFVDCLTVDSHLYTLTNFEKLNHYLIIIFIAHAQHKKETCQ
NT seq 168 nt   +upstreamnt  +downstreamnt
atgcggaaaatttgggtgatcgattgtttatatgcatcaacattctttgtggattgtttg
acagtagacagtcatttgtatacgttaacgaattttgaaaaattgaatcattatttaatc
ataatattcattgcgcacgcgcaacacaaaaaggagacatgtcaatga

DBGET integrated database retrieval system