KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02721
Entry
SAOUHSC_02721     CDS       T00324                                 

Definition
(RefSeq) hypothetical protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
SSDB
Motif
Pfam: Phage_holin_3_3
Other DBs
NCBI-GeneID: 3921597
NCBI-ProteinID: YP_501184
UniProt: Q2FVI9
Position
complement(2502610..2502717)
AA seq 35 aa
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
NT seq 108 nt   +upstreamnt  +downstreamnt
atgttcaatttattaattaacatcatgacttcagctataagcggctgtcttgttgcgttt
tttgcacattggttacgaacgcgcaacaataaaaaaggtgacaaataa

DBGET integrated database retrieval system