KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02859Help
Entry
SAOUHSC_02859     CDS       T00324                                 

Definition
(RefSeq) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00900  Terpenoid backbone biosynthesis
sao01110  Biosynthesis of secondary metabolites
sao01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAOUHSC_02859
Enzymes [BR:sao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SAOUHSC_02859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red YAcAr UPF0180
Motif
Other DBs
NCBI-GeneID: 3921531
NCBI-ProteinID: YP_501315
UniProt: Q2FV77
Position
complement(2630037..2631314)
Genome map
AA seq 425 aa AA seqDB search
MQNLDKNFRHLSRKEKLQQLVDKQWLSEEQFDILLNHPLIDEEVANSLIENVIAQGALPV
GLLPNIIVDDKAYVVPMMVEEPSVVAAASYGAKLVNQTGGFKTVSSERIMIGQIVFDGVD
DTEKLSADIKALEKQIHKIADEAYPSIKARGGGYQRIAIDTFPEQQLLSLKVFVDTKDAM
GANMLNTILEAITAFLKNEFPQSDILMSILSNHATASVVKVQGEIDVKDLARGERTGEEV
AKRMERASVLAQVDIHRAATHNKGVMNGIHAVVLATGNDTRGAEASAHAYASRDGQYRGI
ATWRYDQDRQRLIGTIEVPMTLAIVGGGTKVLPIAKASLELLNVESAQELGHVVAAVGLA
QNFAACRALVSEGIQQGHMSLQYKSLAIVVGAKGDEIAKVAEALKKEPRANTQAAEHILQ
EIRQQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatttagataagaattttcgacatttatctcgtaaagaaaagttacaacaattg
gttgataagcaatggttatcagaagaacaattcgacattttactgaatcatccattaatc
gatgaagaagtagccaatagtttaattgaaaatgtcatcgcgcaaggtgcattacccgtt
ggattattaccgaatatcattgtggacgataaggcatatgttgtacctatgatggtggaa
gagccttcagttgtcgctgcagctagttatggtgcaaagctagtgaatcagactggcgga
tttaaaacggtatcttctgaacgtattatgataggtcaaatcgtctttgatggcgttgac
gatactgaaaaattatcagcagacattaaagctttagaaaagcaaattcataaaattgcg
gatgaggcatatccttctattaaagcgcgtggtggtggttaccaacgtatagcgattgat
acatttcctgagcaacagttactatctttaaaagtatttgttgatacgaaagatgctatg
ggcgctaatatgcttaatacgattttagaggccataactgcatttttaaaaaatgaattt
ccgcaaagcgacattttaatgagtattttatccaatcatgcaacagcgtccgttgttaaa
gttcaaggcgaaattgatgttaaagatttagcaaggggcgagagaactggagaagaggtt
gccaaacgaatggaacgtgcttctgtattggcccaagtagatattcatcgtgcagcaaca
cataataaaggtgttatgaatggcatacatgctgttgttttagcaacaggaaatgatacg
cgtggtgcagaagcaagtgcgcatgcatacgcgagtcgtgacggacagtatcgtggtatt
gctacatggcgttacgatcaagatcgtcaacgattgattggtacaattgaagtgcctatg
acattggcaatcgttggcggtggtacaaaagtattaccaattgctaaagcttcattagag
ctactaaatgtagagtcagcacaagaattaggtcatgtagttgctgccgttggtttagcg
caaaactttgcagcatgtcgcgcgcttgtgtcagaaggtattcaacaaggtcatatgagt
ttacaatataaatcattagctatcgttgtaggggcaaaaggtgatgaaattgctaaagta
gctgaagctttgaaaaaagaaccccgtgcaaatacacaagcagcggaacatattttacaa
gaaattagacaacaatag

DBGET integrated database retrieval system