KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0940Help
Entry
Sulac_0940        CDS       T01746                                 

Definition
(GenBank) Formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00625  Chloroalkane and chloroalkene degradation
sap00680  Methane metabolism
sap01100  Metabolic pathways
sap01120  Microbial metabolism in diverse environments
sap01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Sulac_0940
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sulac_0940
Enzymes [BR:sap01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Sulac_0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N HI0933_like AlaDh_PNT_C Glu_dehyd_C TrkA_N Pyr_redox Pyr_redox_2 FAD_oxidored FAD_binding_2 DAO Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AEW04442
UniProt: G8TSR5
Position
complement(945784..946917)
Genome map
AA seq 377 aa AA seqDB search
MKAVVYQGPFQVAVQEVPEPTIQHPADVIVKITTSCICGSDLHMYEGRTAAEPGIIFGHE
NMGVVVETGSAVSRLKVGDRVVMPFNIGCGHCQNCESGYTAFCTEVNPGFAGGAYGYVAM
GPYPGGQAQYLRVPWADFNALSLPPGREHESDFALLADIFPTGWHGVSLSGFQPGESLVV
FGGGPVGLMAAYSAVLRGASEVYVVDRVPERLEKARQIGTIPINFDQADAVDQILDQRHG
AYVDRAVDAVGYQATQAGREVPNTVLVSMVRVVRATGGLGVPGLYVPSDPGGVDPLAREG
YLSFPVGKFFEKGLKMGTGQCNVKQYNRYLRDLIIAGRATPSFVVSHEISLEDAPLAYEK
FDKRIEGYTKVLIHPND
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggttgtctaccaagggccgtttcaagtagccgtccaagaggttcctgaaccc
acgattcagcatccggcagatgtgatcgtcaaaatcaccacctcctgtatttgcgggtcg
gatttgcacatgtacgaggggcgtacggccgccgagccgggcatcatttttggtcacgaa
aatatgggcgtggtggtcgaaaccggatccgcggtaagtcggttaaaagtcggcgatcgg
gtcgtcatgcccttcaatatcggctgcggccattgccaaaattgtgaatccggttatacg
gccttttgcactgaggtgaatcccggttttgccgggggcgcctacggttatgtcgccatg
ggcccctatcccggcgggcaagcccaatatctacgggtgccctgggctgattttaatgcg
ctcagtctgccccccggccgcgaacacgaatcggacttcgcgttgttggccgatattttc
cccaccgggtggcacggtgtcagtttgtccggattccaacccggcgaatccctggttgtt
ttcggcggcgggccggtcggcttaatggcagcgtatagcgccgtgctccggggcgcctcc
gaagtgtatgttgtcgaccgcgttcccgaacggctggaaaaagctcgtcaaatcggtacg
atcccgattaactttgatcaagcggatgccgtcgaccagattttagatcagaggcatggc
gcctacgtggatcgagcggttgacgccgtaggatatcaggccacgcaagccggccgcgaa
gtgcctaacacggttctcgtctccatggttcgtgtagtacgggcgaccggagggctcggg
gtgcccggcctttatgtgccctcggaccctggaggtgtggacccgttggcacgggaagga
tatctttcgtttcctgtcggcaagtttttcgaaaaaggtctcaagatgggcaccggacaa
tgcaatgtcaagcaatataaccgttatttacgggacttaatcatcgccgggcgagccacc
ccaagcttcgtcgtctctcatgaaatttccctcgaggatgcccctctggcctatgaaaag
tttgataaacggattgaggggtacaccaaagtcttgattcatccgaacgattaa

DBGET integrated database retrieval system