KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_1084Help
Entry
Sulac_1084        CDS       T01746                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00270  Cysteine and methionine metabolism
sap00920  Sulfur metabolism
sap01100  Metabolic pathways
sap01110  Biosynthesis of secondary metabolites
sap01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sap00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Sulac_1084
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Sulac_1084
Enzymes [BR:sap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     Sulac_1084
    2.3.1.46  homoserine O-succinyltransferase
     Sulac_1084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 PGAP1 Peptidase_S28 Abhydrolase_2 DUF2920
Motif
Other DBs
NCBI-ProteinID: AEW04584
UniProt: G8TTZ3
Position
1088444..1089553
Genome map
AA seq 369 aa AA seqDB search
MKDLTAKRRHIWPWQKNQEFPWPSIEWFRSEDPLMLDSQSWLPSYEIAYETWGEPSGQPV
VVFHALTGDSHVAPHDGEDRPGWWDGVLGSGRALDPDTHYILCHNVLGGAMGSTGPSSWD
PEGRPWGSRFPQLSLFDMVRAADRWIQSLVGLRPVILVGGSMGGMLAYAYGALYPERVKG
ILAIGAPIRHEPWAISYHTVGRTAIWSDPAFRGGDYYDGPFPDQGLALARMADMISYQHP
ASMDQKFSRNRQTADGMEFQIESYLRYQGQKLVRRFDANTYITLTQAMDQFELSSQAIRR
LAAIPVWVAGITSDMLYPPAEIERHVALLRDQQVSVTLEWLDGPWGHDTFLVDQNQTNGL
VQRFLAAVE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagacctgaccgcaaagcggcgccatatttggccgtggcaaaaaaatcaagaattt
ccctggccgtccattgagtggtttcggtctgaagaccccttgatgctggattcccaatcg
tggctaccgtcgtatgaaattgcttatgaaacctggggcgagccgagcgggcaacccgtg
gtggtctttcacgccttgaccggtgatagccatgtggctccccacgacggggaagatcga
ccgggctggtgggatggtgtgctcggatccggtcgcgcgcttgacccggatacccattat
atactatgccataatgtgctgggcggagcgatggggagcacgggtccgtcgtcgtgggat
cccgagggacgcccttggggtagccgatttcctcaattaagcctcttcgacatggtgcga
gccgccgatcgttggatccaaagcttggtgggcttgcggccggtgattttagtcggcgga
tccatgggcggcatgttagcctatgcctatggggcactctatccggagcgcgtcaagggc
attttggcgattggggcacccattcgccatgagccatgggcgatatcctaccataccgtc
ggtcggacggcgatttggtccgacccggcctttcgggggggcgactattatgacggcccg
ttcccggaccaaggcttggcgctggcgcgcatggccgacatgatttcctaccagcatccg
gcctcgatggatcaaaaattttcccgtaatcggcagacggccgacggcatggaatttcaa
atcgaatcctatctccgctatcaaggtcaaaaactggtccggcgatttgatgccaatacc
tatatcaccttgacgcaagccatggatcagttcgagctgtcgtcccaggcgattcgccga
ctggcggccattccggtatgggtggccggcattaccagcgacatgctctacccgccggcc
gaaatcgagcggcatgtcgcccttttaagggatcagcaggtctcggtgacgcttgaatgg
ttggacggcccctggggccatgacacgtttttggtcgatcaaaatcaaaccaacggactc
gttcaacgctttttggccgccgtggaataa

DBGET integrated database retrieval system