KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_1461Help
Entry
Sulac_1461        CDS       T01746                                 

Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Brite
KEGG Orthology (KO) [BR:sap00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sap03009]
    Sulac_1461
Enzymes [BR:sap01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     Sulac_1461
Ribosome biogenesis [BR:sap03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Sulac_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AEW04958
UniProt: G8TX50
Position
1438959..1439963
Genome map
AA seq 334 aa AA seqDB search
MEHEPSRRATVDPTEAGRRIDQWLASKWPERSRSAWQKAIKAGQVTVNGRVVPARSLVVA
GDVVQASMPVQDEAAVDADSPPDPVVSSWIVYQDAWILMVNKPRGVVVHPAAGHWSDTLA
QGLRPWIHEAAGERPGIVHRLDKDTTGLMVVARTEAVRHILSQAIQARQVTRQYLAIVRG
HLDPSAGTIDAPIGRDPRHRLRMAVIEPGRSARTHYRTVIRTPHASVVQCTLETGRTHQI
RVHLASVGHPVLGDRLYGGGWPGLFDGQLLHAARLMLIHPVDGRPLDLTTWPPDDWRRFP
EWREAEVVDNRLYPDGAHMSTTEWLTHWQRSGAD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggagcatgaaccaagccgccgagcgacggtcgaccctaccgaagccgggcggcgaatt
gaccaatggttggcttccaaatggccggaacggtctcgatccgcgtggcaaaaagccatt
aaagcgggtcaggtgaccgtaaacggccgcgtcgtgcctgctcgcagcctggtggtggca
ggggatgtggtgcaggcgtcgatgccggttcaggacgaggcggctgtcgatgccgacagt
ccacccgacccggtcgtgagcagctggatcgtctaccaagatgcctggattttaatggtt
aacaagccccggggagtggtggtccacccggcggccgggcactggtcggatacgctggcc
cagggattgcggccttggattcacgaggcggccggtgagcgccccggcatcgtgcatcga
ttggataaagatacgacggggctgatggtggttgcacgcacggaggcggtccgccacatc
ctatcgcaagcgattcaggcgcgccaagtgacccgtcaatatctggcgatagttcggggt
cacctagacccctctgccggaaccattgacgccccgatcggtcgcgatccgcgtcatcgc
ctgagaatggcggtgatcgaaccggggcgatcggctcgcacacattaccggacggtgatc
cggacaccgcacgccagtgtcgtacaatgcacgctcgagaccggtcggacccatcaaatt
cgggtgcacctggcgtccgtcgggcatccggtgttgggtgaccgactctacggcggcggc
tggcctggccttttcgacgggcaattgctacacgcggcgcggttaatgctcatccatccg
gtcgacggtcgaccgttggatttgacgacctggccgccggatgactggcggcggtttccc
gaatggcgggaggcggaggtggtcgataaccgactatatcccgatggggcgcacatgagc
acgacggagtggctgacgcattggcagcgatcgggggcggattaa

DBGET integrated database retrieval system