KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_1826Help
Entry
Sulac_1826        CDS       T01746                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00020  Citrate cycle (TCA cycle)
sap00310  Lysine degradation
sap01100  Metabolic pathways
sap01110  Biosynthesis of secondary metabolites
sap01120  Microbial metabolism in diverse environments
sap01130  Biosynthesis of antibiotics
sap01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sulac_1826
  Amino acid metabolism
   00310 Lysine degradation
    Sulac_1826
Enzymes [BR:sap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sulac_1826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEW05319
UniProt: G8U070
Position
complement(1767762..1768970)
Genome map
AA seq 402 aa AA seqDB search
MSELKVPELGESVVEATVGRWLKQEGEAVSPGEPVVELETDKVNLEVAAETAGVITKILA
PEGSTVAVGSSLATIEAGATAAPPAAVPPVSDSAPVVDEGVRATPDVRRLAKEQGVDLAR
LQGSGPKGRIVRDDVLAATKPPENPVLPPPPPRAPQPEPRALSPDAAWSERQEEHIPMSS
RRLTIARRLVEAQHQAAMLTTFNEVDMSTVLAVRQRRRDAFKERYGVSLGLMSFFTKAVI
GALKAFPRLNAEIRGQEMIIKHYYDIGIAVATDQGLVVPVLRNADRMTFAEIEQQVAELA
RRARDNKLTLDELKGGTFTITNGGVFGSLLSTPILNAPQVGILGMHKIQERPVAVNGQVE
IRPMMYIALSYDHRIVDGSEAVRFLVTVKQFIEDPEALLLEG
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgaattgaaggtaccggaattgggcgagtcggtggttgaagccaccgtaggccgt
tggttaaagcaggaaggggaggccgtctctccgggagaaccggtggtcgaactcgaaacg
gataaagtcaatttggaagtcgcggccgaaacggcgggcgtgattacgaagattctggcg
ccggaaggcagtacggtggcggtcggcagcagtctcgccaccatcgaggccggcgccacc
gccgccccgccggcggcggtccccccggtgtccgactcggcgccggtggtggacgaaggg
gtccgggcgacgcccgatgttcggcgattggccaaagaacaaggggttgatttagctcgg
ctccaaggctcgggtcccaaggggcgcatcgtccgagacgacgtcttggccgccaccaaa
ccgcccgagaatccggttttaccgccgccaccccctcgagctccgcaaccggaaccccgg
gccctatcacccgatgcggcgtggtccgaacggcaggaagaacatatccccatgtcgtct
cgtcggctgaccatcgcacgccgcttggtcgaagcgcaacatcaggcggccatgctcacc
acgtttaacgaagtcgacatgtctacggtgctcgccgtccgtcagcgtcgacgagacgcg
tttaaagaacggtacggtgtgagtcttggattgatgtcgttttttaccaaggcggttatt
ggcgccttgaaagccttcccgcggttaaacgcggaaatccgtggtcaggaaatgattatt
aagcattactacgatatcggcattgccgttgccaccgatcaaggcttagtcgtcccggtg
ttacgaaacgccgaccggatgacgtttgccgagattgagcaacaggttgcggaattggcc
cgccgggcccgcgacaataagctgacgttagacgaactgaaaggcggcacgtttacgatt
accaacggcggggtgtttggatcacttttgtcgacgcctatcttaaacgccccccaagtc
ggcatcttgggcatgcataaaattcaagagcgtccggtggcggttaacggccaagtagag
atccggccgatgatgtacatcgccttgtcctacgaccatcggattgtggacggaagtgaa
gccgttcggtttttagtgaccgtcaagcagtttattgaagaccccgaggccttgttgttg
gaggggtag

DBGET integrated database retrieval system