KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2038Help
Entry
Sulac_2038        CDS       T01746                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00071  Fatty acid degradation
sap00072  Synthesis and degradation of ketone bodies
sap00280  Valine, leucine and isoleucine degradation
sap00310  Lysine degradation
sap00362  Benzoate degradation
sap00380  Tryptophan metabolism
sap00620  Pyruvate metabolism
sap00630  Glyoxylate and dicarboxylate metabolism
sap00640  Propanoate metabolism
sap00650  Butanoate metabolism
sap00900  Terpenoid backbone biosynthesis
sap01100  Metabolic pathways
sap01110  Biosynthesis of secondary metabolites
sap01120  Microbial metabolism in diverse environments
sap01130  Biosynthesis of antibiotics
sap01200  Carbon metabolism
sap01212  Fatty acid metabolism
sap02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sulac_2038
   00630 Glyoxylate and dicarboxylate metabolism
    Sulac_2038
   00640 Propanoate metabolism
    Sulac_2038
   00650 Butanoate metabolism
    Sulac_2038
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sulac_2038
   00072 Synthesis and degradation of ketone bodies
    Sulac_2038
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sulac_2038
   00310 Lysine degradation
    Sulac_2038
   00380 Tryptophan metabolism
    Sulac_2038
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sulac_2038
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sulac_2038
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sulac_2038
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sap04147]
    Sulac_2038
Enzymes [BR:sap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sulac_2038
Exosome [BR:sap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sulac_2038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEW05528
UniProt: G8TSB6
Position
complement(1986300..1987442)
Genome map
AA seq 380 aa AA seqDB search
MEDAVIVDVVRSPIGRAHRGSLIHERPDEVGGFVVDALMKRVPVVSPAEVEDLVVGCGVP
EGEQGYNIARVMALIAGMGTTVPGTTVSRYCASSLQALRMAAHAIWAGEGDVFVAAGVEF
VSRYGRREDHRNLRFLSEDAPPIYISMGLTAENVAVRYGVSRHDQDAYAKRSQDLTRQSR
ESGFWAREIVPVPLSDGTVMREDDSPRPDTTLEGLAQLTPAFREGGTVTAGNSCPLNDGA
AAVLVMSARRARALGLRPRARIVATSVSALDPAIMGMGPVKAVKQVLKRAGMTLHDIDIV
ELNEAFAAQVLAVQRELDIPMEKLNPFGGSIAVGHPYGMTGARLCATLLNGLDTLDQTLG
LETLCVGGGQGMAMIVERLN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgcggtcatcgtcgatgtggtgcgttcgcccatcggtagagcccacagaggg
agtttgatccatgagcggcctgacgaggtggggggattcgttgtcgatgccctcatgaaa
cgggtgccggtcgtaagtccggccgaggtggaggatttggtggtgggttgcggtgtcccc
gaaggtgagcagggctacaatatagcccgggtaatggcactgattgccggtatgggcaca
acggtccccgggactaccgtcagccgctattgcgcctccagcctgcaagccctgcggatg
gccgcccatgccatatgggccggcgagggcgacgtgtttgtagccgcaggggtcgaattt
gtcagtcgctatgggagacgggaagatcatcgcaacctccgctttctgtcggaggatgct
ccgccgatttatatttccatgggtttgacggccgaaaatgtggcggttcgctatggggtg
tcgcgacacgatcaagacgcttatgccaaacggtcccaggatctgacccgacaaagccgc
gaaagcggcttttgggcccgggagattgtaccggtgccgttgtcggacggcacggtgatg
cgtgaggacgacagccctcgtcccgacaccacgttggaaggcttggcgcaactaacgcct
gcctttcgggaaggcgggaccgtcaccgccggcaattcttgcccgctgaatgacggggcg
gccgcggtattggtgatgtcggccaggcgggcacgggccttgggattaaggccccgcgca
cgaattgtggcgacttcagtcagtgcgctggacccggccattatggggatggggccggtc
aaagcggtcaaacaggtgctgaagcgcgctggaatgacgctacacgacatagacattgtc
gaattgaatgaagcgtttgccgcccaggtgctggcggtccagcgcgagctggacattccc
atggagaagttgaaccctttcggcggcagtattgccgtcggtcatccttacggcatgacc
ggagcccgcctgtgcgcgaccttactgaacgggcttgacaccctcgaccagacgctggga
ctcgaaaccctttgcgtcggcggcggtcagggtatggccatgattgtggaacggttaaat
taa

DBGET integrated database retrieval system