KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2279Help
Entry
Sulac_2279        CDS       T01746                                 

Definition
(GenBank) precorrin-2 dehydrogenase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00860  Porphyrin and chlorophyll metabolism
sap01100  Metabolic pathways
sap01110  Biosynthesis of secondary metabolites
sap01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sap00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sulac_2279
Enzymes [BR:sap01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Sulac_2279
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Sulac_2279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Glyco_trans_4_4 Glyco_transf_4 DUF4693 TrkA_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AEW05749
UniProt: G8TU77
Position
complement(2253723..2254223)
Genome map
AA seq 166 aa AA seqDB search
MTNLYPVFLRLEKQPCLVVGGGRVALRKIRRLREAGADVTVISPDLHPELVQNDVIWINR
AYEPGDVVRIRPVLVFAATNRPAVNRLVRQEAEEAGVWVNQADDPDGCRFMVPASVDRPP
FHLAVSTGGTDPALAAALRRALEADLADGGQRFVTLLRTTLEPPES
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgactaatctttatccggtgttcttgcggttggagaaacagccgtgcctggtggtcgga
gggggtcgggtggcccttcgaaaaatccgccgattgcgggaggcgggtgccgacgtgacc
gtcatcagccccgaccttcatccggagttggtccagaacgacgtgatttggataaaccgt
gcttatgaacccggggacgttgtccgcatacgtccggtgttggtgtttgccgccaccaac
cgacccgcggtcaatcgcctggtccggcaggaagcggaagaagccggcgtatgggtcaac
caggccgacgatccggacgggtgccggtttatggtacccgccagcgtggaccggcctccg
tttcatctggccgtatccaccggcggtaccgacccggcgctggcggccgcccttcggcga
gcgttggaagccgatttggccgacgggggccagcggtttgtcaccctgctccgaacgact
cttgaaccgccggaatcttga

DBGET integrated database retrieval system