KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2307Help
Entry
Sulac_2307        CDS       T01746                                 

Definition
(GenBank) Amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00330  Arginine and proline metabolism
sap00360  Phenylalanine metabolism
sap00380  Tryptophan metabolism
sap00627  Aminobenzoate degradation
sap00643  Styrene degradation
sap01100  Metabolic pathways
sap01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Sulac_2307
   00360 Phenylalanine metabolism
    Sulac_2307
   00380 Tryptophan metabolism
    Sulac_2307
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sulac_2307
   00643 Styrene degradation
    Sulac_2307
Enzymes [BR:sap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     Sulac_2307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEW05776
UniProt: G8TUQ2
Position
2283348..2284547
Genome map
AA seq 399 aa AA seqDB search
MKDTWHAFIDPSCTLPPIQDGPLSGTRFAAKDVFAVKGYPTSGGNPDWFRTHPPETTTAP
AILALLKAGAALDGKTHTDELMYGLNGENVHYGTPVNPKAPDRIPGGSSSGSAVAVSAGM
VDFAIGTDTGGSVRIPASYTGIFGMRPTVGRTTLTGVIPLSQTFDTVGWFSRDPGLLALV
GSVLLSGHSRPAQFRRVIIASDAWALMEPPYRPMLQSWVDRIVQRFEQVEEEPIAPEGLD
QWAQGFRVIQGYDIWQNFGEWITHTKPRFGPGFRERFAWTATITVEERDMWNAKRQIWQS
NLAERLGTDTIILLPTAPGPAPQRNTPLPILNAFRDRVLQLTAIAGLGGLPQISLPGVVS
PEGYPLGLSVIGGSGTDEALMEWVQQQMAEWGIDHAHAD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatacctggcatgcctttatcgatccctcttgtacgttaccgccgatccaagac
ggccccttgtcgggcacccgatttgcggccaaagacgtctttgcggtcaagggttatccc
acctccggcgggaatcccgattggtttcgcacgcacccgccggaaacgaccactgccccc
gccatcctcgcgttgttgaaagccggcgccgccttagacggcaaaacgcatacggatgaa
ttgatgtacgggttaaacggggaaaacgtccactatggtactcccgtgaaccctaaagcc
cccgaccggattccggggggatcgtcttcgggttcagcggttgccgtctcggcgggtatg
gttgacttcgctattggcaccgacaccggcggctccgtacgtatcccggccagctacacg
ggtatttttggtatgaggccaaccgtcggccgaacgaccctgaccggcgtaatcccgctg
tcccagacctttgatacggtcggatggtttagccgcgatcccggcttgctcgcgttagtg
ggttcggttttgctctcgggtcactcccgacctgcccaatttcgccgcgtgatcatcgcg
tcagacgcctgggcgctgatggagccaccctatcgcccgatgttgcagtcttgggtcgac
cgcatcgtgcaaagatttgagcaggtggaagaggaaccgatcgcacccgaaggattggac
caatgggcgcagggcttccgcgtcattcaaggctatgacatttggcagaactttggcgaa
tggattacccatacgaaaccccgattcggtccgggatttcgtgaacggtttgcctggacc
gccaccatcacggtagaagaacgcgatatgtggaacgcgaagcgccaaatctggcaatcg
aacctggccgaacggttaggcacggacacgatcatcctgttgccgacggcgccgggaccg
gcgcctcaaagaaacacccccttaccgatcttgaacgcatttcgcgaccgggtgttgcaa
ctgacagcaatcgccggactaggcggattgccgcagatctccctacccggcgtggttagt
cccgagggctatccgctgggactgtccgtcatcggcggatccggcaccgacgaagccctc
atggagtgggtccaacagcaaatggccgaatgggggatagaccatgcgcacgcggattaa

DBGET integrated database retrieval system