KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2854Help
Entry
Sulac_2854        CDS       T01746                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00620  Pyruvate metabolism
sap00680  Methane metabolism
sap00710  Carbon fixation in photosynthetic organisms
sap01100  Metabolic pathways
sap01120  Microbial metabolism in diverse environments
sap01200  Carbon metabolism
Module
sap_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sulac_2854
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Sulac_2854
   00680 Methane metabolism
    Sulac_2854
Enzymes [BR:sap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sulac_2854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEW06315
UniProt: G8TZ45
Position
complement(2819075..2821636)
Genome map
AA seq 853 aa AA seqDB search
MNLLWSLLDDVVRGEDNPHLVDDAHGYFDEVLQHRESGGFQPKPDVREAEALARYFTERL
RLQNLAEDLARAKVVEMRRKDGSEPPRGSLNQLAKLLDQRQAEPFGRPLVGRMVLTFHPT
ESTRRTILQHIRKLGQLLDPASGVSVAHAQHDTQIFRLREEIRALWRTPSRRQDRPTVLD
EVELGIFYLEHSLFSMLPDLLLELDQVLARHRLGRIDWAVDSWIGGDRDGHPQVTAQVTE
HTLRRHQETILRLYQPLLDDLERTLTASDRYLEKSEQCRRWIALLAEEFPDVADVLARRY
PMEPLRQMVGLMRERLAATLNHDPRGYRQAHQFRQDVEQLGRFWDADPDRWPYELKRLLR
QIDIFGFHLASLDIRQHSRVHIEGVVDLAGEEYRTLSERDKMKVLAQLIEHPPAWIPSSS
VTAELKETFQVISQARRQYGPRAVSRYLVSMAHHASDLLAVLALGRAVDPELSLDIIPLV
ETLDDLENAVVILDQAFQEPVWRQHLQSRQFYQEVMLGYSDSTKDAGTFTASWKIYQAQN
QLMLWAEQHGVTLGFFHGRGGALGRGGGPTSYAILGQPPKTRLSPLRMTQQGEVLSQKFL
LPSLAWRSLELMTVAHVQHAADPGWEPDADTVGWMDHLGDLAVKTYRELVHAPGFWEYFL
AVTPIREMSALNWGSRPSWREQFCWDDLRAIPWVFAWTQNRMGIPAWYGAGTALDQALSQ
PEGLSRIQMLRRQWPFLNTMLHNLELALVKSDDMVAEAYQSLATPELKDRFWPLIQEERR
RLTNALQAISGGPPLSGQPRLKTAVTWRNPQVDALNYLQIELLKTYRATEDPKLLPILSQ
TMEGIALGLRNTG
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
gtgaacttgctgtggtcgctattggatgatgtggttcggggagaagataatcctcacttg
gtggatgacgcgcacggatatttcgatgaggtgctgcagcatcgggaatccggcgggttc
cagcccaagccggatgtacgggaagcggaagcattggctcggtattttacggagcggctt
cgattgcaaaacctggccgaggatttggcgcgggctaaagtcgtcgaaatgcgccggaaa
gatggcagtgagccaccccgtggatcgttgaatcaattggccaagctcttggatcagcgg
caggccgagccgtttggccgcccccttgtaggtcgtatggtgcttacgtttcatccgacg
gaaagtacgcgacggacgatcttgcagcacattcgcaaattaggccagctcttggatccc
gcatcgggtgtctcggtagcccatgctcaacatgacacgcaaatcttccggttgcgggaa
gagattcgggcgctttggcgaacccccagtcggcgtcaggatcgcccgacggtgcttgac
gaagtggagcttggcattttttatttagaacacagtttattttccatgttaccggatctc
ttgctggaactcgatcaggtcttggctcggcatcggttggggcggattgactgggcggtg
gactcctggattgggggcgaccgcgacgggcatccccaggtgaccgctcaggtgaccgag
cacacgcttcggcggcatcaagagacgattttgcgactttatcagccgctgttggatgat
ttggagcggaccttaacggcaagcgatcggtatctggagaagagcgaacaatgccggcgg
tggattgcgcttttggccgaagagtttcctgacgtggcggatgtcttggcgcggcggtac
ccgatggagcctctgcggcagatggtcggcctgatgcgcgagcggctggcggcaacgctg
aaccacgatcctcgcggatatcggcaagcgcatcaatttcggcaggatgtggagcagtta
ggtcgtttttgggatgccgatcccgaccgttggccctatgaactaaagcgccttttgcgt
cagatcgatatcttcggatttcacttggccagtttggatattcgccagcatagccgcgtg
cacattgaaggcgtggtcgatctggccggtgaggaatatcggacattatccgagcgcgac
aagatgaaggtgttagcgcaattgattgagcatccaccggcgtggattccttcgtcgtcc
gttaccgccgagctgaaagagacatttcaggtcatttctcaagcgcgccgtcaatacggc
ccgcgtgcggtgtctcgttacttggtcagtatggctcatcacgccagtgatttattagcc
gttttagcgctcggtcgagccgtagatccggagttgagtctcgacatcatccccttggtg
gaaactctggatgacctggaaaatgcggtggtgattttagatcaggcttttcaggagcct
gtctggcgccagcatctgcagagtcggcaattctatcaagaggtgatgctcggctattcg
gacagcacgaaggatgccggaacatttacggccagttggaaaatttatcaggctcaaaac
caattgatgctctgggcggagcaacatggcgtcacgttaggatttttccatggccggggc
ggggccttgggacgcgggggcggtcccacgtcgtacgccattttagggcaacccccgaag
acgcgattaagcccgcttcggatgacgcagcaaggtgaggtgttgtcccaaaaattcttg
ttaccctcgttagcctggcgaagcttggaactgatgacggtggctcatgttcagcatgcg
gcggatccgggatgggaaccggatgcggacaccgtcggctggatggaccatttaggtgac
ctggcggttaaaacctatcgcgaattagtccatgccccgggattttgggaatacttcttg
gcggttacgcccattcgggaaatgtcggccttaaattggggctctcggccgtcttggcgg
gaacaattttgctgggatgacctgcgtgccattccctgggtcttcgcatggacccaaaat
cggatggggatacctgcctggtatggggccgggacggccctcgaccaagccctaagtcaa
ccggaggggttatcgcgcattcaaatgcttcgccgacagtggccgtttttgaacaccatg
ctgcataatttggagttggcactcgtcaagtcggatgacatggtggccgaggcctatcaa
tcgttggccacgcccgagctcaaagaccggttttggccgctgatccaagaagaacggcga
cgtctgaccaatgctctgcaggcgatctccggggggccgcctttgtctggtcaaccgcgc
ctaaaaaccgcggtgacctggcgtaatccgcaagtggatgcgttaaactatttgcaaatc
gaattgctgaagacctaccgggcgacagaggatccgaagttgttgccgattttgtcgcag
accatggaaggaattgcattgggcctgcggaataccgggtaa

DBGET integrated database retrieval system