KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_3206Help
Entry
Sulac_3206        CDS       T01746                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00230  Purine metabolism
sap01100  Metabolic pathways
Module
sap_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sulac_3206
Enzymes [BR:sap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sulac_3206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin MMR_HSR1 RsgA_GTPase AAA_18 AAA_22 AAA_16 ATPase_2 Adeno_IVa2
Motif
Other DBs
NCBI-ProteinID: AEW06652
UniProt: G8TSG0
Position
complement(3154077..3154676)
Genome map
AA seq 199 aa AA seqDB search
MEPILFIFSGPSGAGKGSVMRALLERDAQLKKVVTYTTRQPRPGEVDGFDYRFVSVTEFQ
RLIQTGAVFEYEQVYHDHFYGSPRELFVPDHDGIIELDYKGRLKYESRHRRVVSIFLLPP
SLEELRRRILSRSEVSNLDARLANAVEQLRHARSYDYIVKNDDLDTCIERVEYIIRTERI
RRLGQHELDKMLADLREGG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttggaaccgattttgtttattttttcggggccgtccggtgccggcaaaggctcggtgatg
cgagcgttactggagcgggacgcccaacttaaaaaagtggtcacctatacgacccgtcag
ccgcgcccgggcgaggtcgacggattcgattaccggtttgtctcggtaacggaatttcag
cggttgattcaaaccggtgcggtgtttgaatatgagcaagtctatcatgatcacttttat
gggtctcctcgggaattatttgtccccgaccatgacggtattatcgaactggattataaa
gggcggctgaaatatgaatcgcgacatcgtcgggtcgtctcgattttcctgcttccgccg
tcgttagaggaacttcggcggcgtatcttatcccggtccgaggtatccaacttggatgct
cggctggcgaatgctgtggaacaactacggcatgcccgcagttatgactacatcgtaaaa
aatgacgacttggacacgtgcatcgaacgggtcgaatatatcatccgcaccgagcgaatc
cgtcggctaggccagcacgaattggataagatgctggcagatttgcgtgagggcggttga

DBGET integrated database retrieval system