KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_3293Help
Entry
Sulac_3293        CDS       T01746                                 

Definition
(GenBank) Methylthioribulose-1-phosphate dehydratase
  KO
K08964  methylthioribulose-1-phosphate dehydratase [EC:4.2.1.109]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00270  Cysteine and methionine metabolism
sap01100  Metabolic pathways
Module
sap_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:sap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Sulac_3293
Enzymes [BR:sap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.109  methylthioribulose 1-phosphate dehydratase
     Sulac_3293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AEW06739
UniProt: G8TT39
Position
3242971..3243609
Genome map
AA seq 212 aa AA seqDB search
MIPLDFTPVSTLMTISRRLAEYGWLPATSGNLSLKAPDTSVWITRSGADKQVLAAEDILH
MSPSGMILAGQGKPSFETAIHLAIYQVTDATAVFHVHTVANNLIARYGTHGTVTLGPHEM
VKALDHWEETAQLHLPVLPNLLDMDQLARRIVDRLDPKVPGILLENHGIYVFGRSPALAL
RYLEAWEFLFRWTLESRLHDALDRLLLLNNRI
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgattcccctggatttcacgccggtatccactctcatgaccataagccgtcggttggcc
gaatacggctggctgcccgcaacctccggtaatctttcgctaaaagctccggatacctcg
gtctggattacccgtagcggagccgacaaacaggtcttggcggccgaggacattttacac
atgagtccttccggtatgatattagccggccaggggaagccctcttttgagacggccatt
cacttggccatttaccaggtaaccgacgcgaccgcggtgtttcacgtccacactgtcgcc
aataacctgatcgctcgatacggcacacacggcacggtcacgctcggtccccatgaaatg
gtgaaagccctggaccattgggaagagaccgcccaattgcatctacccgttttgcccaat
ttgttggatatggaccaacttgcccggcgcatcgttgaccgtctcgaccccaaggtgccg
gggatcctcctcgaaaatcatgggatctatgtgttcggccggtctccggccctggcgctg
cgctatctcgaagcgtgggagtttttatttcggtggacgctggaaagtcggctccatgat
gcgttggatcgcttgttattgctcaataatcggatatag

DBGET integrated database retrieval system