KEGG   Spiroplasma apis: SAPIS_v1c05130Help
Entry
SAPIS_v1c05130    CDS       T02945                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
sapi  Spiroplasma apis
Pathway
sapi00450  Selenocompound metabolism
sapi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sapi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SAPIS_v1c05130 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sapi03016]
    SAPIS_v1c05130 (selD)
Enzymes [BR:sapi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     SAPIS_v1c05130 (selD)
Transfer RNA biogenesis [BR:sapi03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    SAPIS_v1c05130 (selD)
 Prokaryotic Type
    SAPIS_v1c05130 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AHB36358
UniProt: V5RIP9
Position
complement(617201..618187)
Genome map
AA seq 328 aa AA seqDB search
MKDINCMGGCSSKLDNNRLTKILKLASTNLIGNEDSSIWNLENGKSLIESLDFFPQISDS
LYTYGQITACNSISDIYAMGGKPEFALSILTVTKDMSDEDIALIIKGMKSILDPLKIKIL
GGHTIITNDLLCGLSVTGFVDNIDLKLNNTPKVGDILVISKPLGFGTIMAAKSIDMVNSN
DYEEAIRWMTTPNELASIQSIKYNFNSLTDVTGFGLAGHLLEKLNNKFTASIQFKSIPLI
KNVLDYLGNYIVNGALANNRRNYSKDIYFDEDTPFAMRQIFFDPQTSGGLLGTLSEKEYL
RLIQDPKNVFTKIGVIKEKSNYLIKVEI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagatataaactgtatgggtggttgtagttctaaattagataataatagattaact
aaaattttaaaattggctagcacaaatttaattggaaacgaagactctagtatttgaaac
ttagaaaacggaaaatccttaatagaatctttggatttctttccccaaatttcagattca
ttatatacctatgggcaaataacggcttgtaattctataagcgatatatatgcaatgggt
ggcaaacctgagtttgctttatctattttaacagtgacaaaagatatgtcagatgaagat
attgccttaattataaaaggaatgaagtcaatattagatccattgaagatcaaaatatta
ggaggacatacaattattactaatgacttattatgtggtttaagtgttactggatttgtt
gacaatattgaccttaaattaaataacactccaaaagttggagatatcttagtaatttct
aagcctcttggttttggaacaattatggcagctaaatcaattgatatggttaattcaaat
gattatgaagaagctattaggtgaatgacaacaccaaatgaattagctagtattcaatca
attaaatataattttaactcattaactgatgtcactggttttggtcttgctggacactta
cttgaaaaactaaataataaatttacagcatctattcaattcaaaagtatcccattaatt
aagaatgttttggattacctaggcaattatattgttaatggtgctttggctaataataga
cgtaattattcgaaagatatatattttgatgaagataccccttttgctatgagacaaata
ttttttgatcctcaaacatctggtggacttttaggaacactttctgaaaaagagtatctt
agattgattcaagaccctaaaaatgtttttactaaaattggtgtaataaaagaaaagagt
aactatcttataaaggttgaaatttaa

DBGET integrated database retrieval system