KEGG   Scedosporium apiospermum: SAPIO_CDS5871
Entry
SAPIO_CDS5871     CDS       T06367                                 

Definition
(RefSeq) Delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
sapo  Scedosporium apiospermum
Pathway
sapo00100  Steroid biosynthesis
sapo01100  Metabolic pathways
sapo01110  Biosynthesis of secondary metabolites
Module
sapo_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:sapo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    SAPIO_CDS5871
Enzymes [BR:sapo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     SAPIO_CDS5871
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 27724943
NCBI-ProteinID: XP_016642425
UniProt: A0A084G5L4
Position
Unknown
AA seq 487 aa
MAPKSKTPAVSAPVHEGYEFGGPLGAAAISFGLPILMYVFTFACNDISGCPAPSLLNPKT
LDLGQLKREVGWPEDGIIGVFDLNVTLYVLAYYLVNALLYGILPASEVQGTELATGGRLT
YRFNAFTSHMIILAVCVAGTVQSGASFTLWTYISDNYLQIFTANLLLATFLATFVYVRSF
SVKPGNKEMRELAAGGQTGNMMYDWYIGRELNPRVTLPIIGEMDIKVWFELRPGLLGWLL
LNAAWVAQQYRNYGYITDSIAFIAGIQSLYIIDSWINESSILTMIDITMDGFGFMLSFGD
IAWVPFLYSTQTRYLSIYPVTLGPTGIAAMLAVLGTGFYIFRSSNNEKNLFRTNPNDPRV
SHLEYIQTKTGSKLLVTGWWGTARHINYFGDWIQAWPYSLPTAIAGYTILAAGTGAEGAF
VMADGREVVQGAARGWGMLFTYFYVLYFGVLLIHRDGRDDQKCLRKYGDDWIEYRRRVKW
RIIPYVY
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggcaccaaaatccaagacacccgccgtgagtgcgccggtgcacgaaggctacgaattc
ggcggacctctcggtgccgctgcgatttctttcggtctcccgatcctaatgtatgtcttc
acattcgcgtgtaacgatatttcgggatgccctgctccgtcgctattaaaccccaagacc
ctcgatctcggccaattgaagcgtgaggtcggctggcccgaggatggcatcatcggcgtg
ttcgatctcaatgttacgctctatgtgttggcctactacctggttaatgcgctactctac
ggcatcctccccgcgagcgaggtgcagggcacggagctcgctaccggtggccgtctcacg
taccggtttaatgccttcacctcgcacatgatcatcctcgccgtgtgtgtggccggtact
gttcaatccggcgccagcttcacactctggacctacatcagcgacaactacctccagatc
ttcacggccaacctcctgctcgcgactttcctcgccacgttcgtctacgtccgaagcttc
agcgtcaaacccggcaacaaggagatgcgcgagctcgcagccggcggtcagacgggcaac
atgatgtacgactggtacattggtcgcgagctcaacccgcgtgtcacgctccccatcatc
ggcgagatggatatcaaggtctggttcgagctgcgaccaggcctgctcggttggctcctc
ctcaacgccgcctgggtcgctcagcagtaccgcaactacggctacatcacggacagcatc
gccttcattgcgggtatccaatccctgtacatcattgactcgtggattaacgagtcgtcc
atcctcaccatgatcgacatcaccatggatggtttcggcttcatgctgtctttcggtgac
atcgcgtgggtgcctttcctctactcgacccagacgcgttacctttccatctacccggtc
accctcggtcctaccggcatcgcagccatgctcgccgtgctcggtacgggcttctacatc
ttccgctcctccaacaacgagaagaatctcttccggaccaaccccaacgaccctcgcgtg
tcgcacctcgagtacatccagaccaagacgggcagcaagcttcttgtcacgggttggtgg
ggcacggcgcgtcacatcaactactttggtgactggatccaggcctggccgtatagtttg
ccgacggccatcgctggatacacgatccttgcggcgggcaccggggccgagggtgcgttc
gtcatggccgatggcagggaggttgtccagggtgccgccagaggttggggcatgctgttc
acatatttctacgttctttactttggcgtcttgctcatccaccgtgatggcagggatgac
cagaagtgcctaaggaagtacggtgatgattggattgagtataggcggagggtcaagtgg
aggatcattccttatgtgtattaa

DBGET integrated database retrieval system