KEGG   Salinispora arenicola: Sare_0402Help
Entry
Sare_0402         CDS       T00613                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
saq  Salinispora arenicola
Pathway
saq00010  Glycolysis / Gluconeogenesis
saq00260  Glycine, serine and threonine metabolism
saq00680  Methane metabolism
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
saq01120  Microbial metabolism in diverse environments
saq01130  Biosynthesis of antibiotics
saq01200  Carbon metabolism
saq01230  Biosynthesis of amino acids
Module
saq_M00002  Glycolysis, core module involving three-carbon compounds
saq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sare_0402
  Energy metabolism
   00680 Methane metabolism
    Sare_0402
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sare_0402
Enzymes [BR:saq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sare_0402
Membrane trafficking [BR:saq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Sare_0402
Exosome [BR:saq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sare_0402
  Exosomal proteins of melanoma cells
   Sare_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABV96331
UniProt: A8LZG5
Position
463329..464096
Genome map
AA seq 255 aa AA seqDB search
MTASEGPTVGTLVLLRHGESDWNAKNLFTGWVDVDLTGKGETEARRGGELLREHNLLPDV
VHTSLLRRAIRTAELALETAERNWIAVRRSWRLNERHYGALQGKNKKQTLDEYGEEQFML
WRRSYDTPPPPIADDDEWSQVGDPRYRLLPTELMPRTECLKDVVERMLPYWYDSIVPDIL
AGRTVLVAAHGNSLRALVKHLDQISDEAIAKLNIPTGIPLRYDLDPQLRPMTLGGTYLDP
TAARDAAAAVANQGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgactgctagtgaggggcccaccgtcgggacgctggtcctgctacgacacggtgagagc
gactggaacgccaagaacctcttcaccggctgggtcgacgtggacctgaccggcaagggg
gagaccgaggcgcgtcgcggcggtgagctgctgcgtgagcacaacctgttgccggacgtg
gtgcacaccagcctgcttcgccgggcgatccgcaccgcggaactggcgctggagaccgcc
gaacggaactggatcgcggtacgtcgctcctggcggctcaacgagcgccactacggcgcc
ctgcagggcaagaacaagaagcagacgctcgacgagtacggcgaggagcagttcatgctc
tggcgtcgctcgtatgacacaccgccacctccgatcgcggacgacgacgaatggtcgcag
gtcggagacccgcgctaccggctgttgccgaccgagctgatgccgcggacggagtgcctg
aaggacgtcgtggagcggatgctgccgtactggtacgactcgatcgtgccggacatcctg
gctggccggacggtgctggtggccgcgcacggcaactcgttgcgtgccctggtgaagcac
ctggaccagatcagtgacgaggccatcgcgaagctgaacattccgacgggcatcccgctg
cgctacgacctcgatccgcagttgcgcccgatgacactcggtggcacctacctggacccg
acagcggcacgcgatgccgctgcggcggtggcgaaccagggccgctga

DBGET integrated database retrieval system