KEGG   Salinispora arenicola: Sare_0692Help
Entry
Sare_0692         CDS       T00613                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
saq  Salinispora arenicola
Pathway
saq00040  Pentose and glucuronate interconversions
saq00052  Galactose metabolism
saq00500  Starch and sucrose metabolism
saq00520  Amino sugar and nucleotide sugar metabolism
saq01100  Metabolic pathways
saq01130  Biosynthesis of antibiotics
Module
saq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sare_0692
   00052 Galactose metabolism
    Sare_0692
   00500 Starch and sucrose metabolism
    Sare_0692
   00520 Amino sugar and nucleotide sugar metabolism
    Sare_0692
Enzymes [BR:saq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sare_0692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ABV96612
UniProt: A8M1Y9
Position
765911..766867
Genome map
AA seq 318 aa AA seqDB search
MSEHSANPSSTATTTGGHRAVKAVIPAAGLATRFLPATKAVPKELLPVVDRPVLQYIVEE
ATQAGITDILLVTGRGKTSMIDHFDRRPDLEERLAKKPDLLAAVKQTEDLAAIYSCRQPE
QLGLGHAVGCAESHVGEQPFAVLLGDEFVKPTEPLLPAMLELQARTGGVVLAFFEVDPAE
TTRYGIASVAPAEPEFADIADVVRVTGMVEKPKPEDAPSNLAVLGRYVLPGRIFNAIHRT
EPGSGGEIQLTDAMEILRTEGVPVHAIVYRGTRYDTGMPLGYLQTVVQIAAERDDLGAEF
RKWLAEFVNADEPGGPST
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcactcagcgaacccctcatcgacggccacaacgactggcgggcaccgcgcg
gtcaaggccgtgatcccggccgccgggctcgccacccgcttcctgcccgctaccaaggcg
gtacccaaggaactgctcccggtggtcgatcggccggtgttgcagtacatcgtcgaggag
gcaacgcaggccgggatcaccgacatcctgttggtcaccgggcggggcaagacctcgatg
atcgaccacttcgatcgtcgccctgacctggaagagcggctggcgaagaagcctgacctg
ctagccgccgtcaagcagaccgaggacctggccgccatctactcctgccggcagcccgaa
caactcggtcttgggcatgccgtcggctgcgccgagtcacacgtcggtgagcagcccttc
gctgtgctgctcggtgacgagttcgtgaagccgaccgagccactgctgccggcaatgttg
gagctgcaggcccgtacgggcggggtcgtgctggcattcttcgaggtcgaccccgccgag
accacccgctacggcatcgcctcggtggcgccggccgagccggagttcgccgacatcgcc
gacgtggtccgggtgaccggcatggtggagaagccgaagccggaggacgctcccagcaac
ctcgccgtgttgggccgctacgtgctgcccggtcgcatcttcaacgctatccaccgaacc
gagccgggcagcggtggggagatccaactgactgacgcgatggagatcctccgtaccgag
ggggtgccggtgcacgccatcgtctaccgcggtacccggtacgacaccggcatgccgttg
ggctatctccagaccgtcgtacagattgccgccgagcgtgacgatctcggcgccgagttc
cgtaagtggctcgccgagttcgtcaacgcggacgagccgggtggtccgagtacatga

DBGET integrated database retrieval system