KEGG   Salinispora arenicola: Sare_1797Help
Entry
Sare_1797         CDS       T00613                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
saq  Salinispora arenicola
Pathway
saq00072  Synthesis and degradation of ketone bodies
saq00650  Butanoate metabolism
saq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Sare_1797
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Sare_1797
Enzymes [BR:saq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Sare_1797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR Sacchrp_dh_NADP Methyltransf_11 NAD_binding_10 TrkA_N Shikimate_DH AdoHcyase_NAD NAD_binding_7 RmlD_sub_bind 2-Hacid_dh_C Methyltransf_25 Profilin Polysacc_synt_2 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABV97683
UniProt: A8LXW6
Position
complement(2070319..2071101)
Genome map
AA seq 260 aa AA seqDB search
MTADPRTTPHVVQVDLTGRTALVTGGGSGIGRTCARRLGAAGATVVVVDRDLAAARAVAA
EVGGRAVGVDLADPEAVDRLDTNVDIVVNNAGLQHVAPVEEFAVERFEHLHRVMVQAPFL
VIRRALPHMYAERWGRIVNISSVHGLRASPYKAAYVSAKHALEGLSKVVALEGAGHGVTA
NCISPAYVRTALVQDQIVDQAAIHGISETEVVEKIMLARAAIKRLIEPEEVAELVAYLCS
PPAAFITGASIALDGGWTAN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagatcccaggacgaccccccacgtcgtacaggtcgatctcaccggccggacc
gccctggtgaccgggggcgggagcggcatcggacggacgtgcgcgcggcggctgggcgcg
gccggcgccacggtggtcgtggtggaccgtgacctcgccgcggcccgggcggtcgccgcc
gaggtgggcggccgggccgtgggcgtcgacctggcggacccggaggcggtcgaccgcctc
gacaccaacgtcgacatcgtggtgaacaacgccggactccagcacgtcgccccggtcgag
gagttcgccgtggaacgcttcgaacacctgcatcgggtgatggtccaggccccgttcctc
gtcatccgccgggccctgccacacatgtacgccgaacggtgggggcgcatcgtcaacatc
tcctcggtgcacgggctgcgcgcctcgccgtacaaggcggcgtacgtgtcggcgaaacac
gcgctggaggggctgtccaaggtggtggcgctggagggcgccgggcacggggtgacggcc
aactgcatcagcccggcgtacgtgcgcaccgcgctggtgcaggaccagatcgtggaccag
gccgccatccacggcatctcggagaccgaggtcgtcgagaagatcatgctggctcgggcg
gccatcaagcggctgatcgaaccggaggaggtggccgagttggtggcgtacctgtgctca
ccaccggcggcgttcatcaccggtgcgtccatcgcgctcgacggaggctggacggcgaac
tag

DBGET integrated database retrieval system